KEGG   Trichoplax adhaerens: TRIADDRAFT_22925Help
Entry
TRIADDRAFT_22925  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K01359  
proprotein convertase subtilisin/kexin type 1 [EC:3.4.21.93]
Organism
tad  Trichoplax adhaerens
Brite
Enzymes [BR:tad01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.93  proprotein convertase 1
     TRIADDRAFT_22925
Peptidases [BR:tad01002]
 Serine Peptidases
  Family S8: subtilisin family
   TRIADDRAFT_22925
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 726 aa AA seqDB search
MAQSKGNYSIAILLGLFFISLTTAAVAAAINDQNDDIKDDDEDGISKRYSNTWIVKIPGG
RKRADEVAHKLGYTNLGRISDLDLYNFRHDDVPRRSKRAIHDRTRRLAEDDNVEWVEQEL
IKYRYKRNADLEFNDYLWPKQWYLHDKRDARFDINVLPVWQKNITGKGVVVTILDDGLEH
SHPDIKYSYDPEASYDYNDYDNDPEPRYDSRSSNRHGTRCAGEITMKPNNKMCGVGVAFG
ARIGGIRMLDGSITDGVEASSLGHNMQHVDIYSASWGPNDNGRTVDGPGDIVMKILRKGV
TKGRGGLGSIYAWASGNGGRRGDNCNCDGYVNSIYTIAVSSASYNGTPPWYAEDCTPALA
STYSSGADALKKVASIDLRGGCTTSHTGTSASAPMAAGIYALVLEANPNLTWRDVQHATV
WTSNRKNLTKSGWARNGASRLYHHKFGFGILDAAALVDIVDPKVWKTVPEQKFCPLTADK
IEREISSEGIVRIQIKSHGCQDSKDSINYLEHVQLISTIDFSRRGDLDITLISPSGTRSN
LLSRRLRDSSASGFNSWPFMSTHFWGENPRGTWTVEIKNVGMTNEHGFVRETMLVFYGTE
TMPDVMRRVLSKDDVKLTSNHQSSQSHHGEVMKGKIHEEGHFGSNLNQAEHNSNINEHIF
DKHEGNRYDHLEKNDVHPLHRSFHKKYSGDSDMPAHLLRYYAQILKRKNRNNYSKRSKLY
RYQRDF
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atggctcaaagtaaaggaaattattcaattgcaattctcttaggtctattttttatttcc
ttaactactgcagcagtagctgctgctataaatgatcaaaacgatgatattaaggatgat
gacgaagacggcatctctaaacgctattctaatacatggattgttaaaatacctggtggt
aggaaaagagccgatgaagtagcgcataaattgggctataccaatcttggccggatttcc
gatttagacctatacaactttaggcacgatgacgttccaaggcgatcaaaacgtgctatt
catgatcgaacaagacggctagctgaagatgataatgtagagtgggtagagcaagaactc
atcaaatatcgatataagcgcaatgctgatttggaatttaatgattacctctggccgaaa
caatggtatcttcatgacaaaagagatgctcgatttgacattaatgtccttcccgtctgg
cagaaaaatatcactggaaaaggggtcgtagtgaccatattggatgatggtcttgaacat
tcacaccctgacattaaatatagctacgatcctgaagcaagttatgattataatgattat
gataatgatccagagccaagatatgacagtcgaagttctaatagacacggtacacgttgt
gcgggtgaaattaccatgaaacctaataataaaatgtgtggtgtaggtgtcgcttttgga
gctagaattggaggaattcgaatgttagatggttctattactgatggtgttgaagcttca
tcattgggccataatatgcaacatgtcgatatctatagtgcaagctggggacctaatgat
aatggtaggactgtcgatggcccaggtgatattgttatgaaaatccttagaaaaggagta
acaaagggacgtggaggtttaggatcaatttacgcctgggcatctggtaacggaggaaga
cgtggtgataactgtaactgtgatggctacgttaatagcatttacaccattgctgttagc
tctgcttcttataatggaactccaccttggtatgcagaagattgtacaccagctttagct
tctacttacagtagtggtgctgatgcactaaagaaagtggcttctatcgatttacgaggt
ggatgtactactagccatactggcacttcagcttcagcacctatggctgctggtatctat
gctctcgttttagaagcaaatcctaacctgacatggcgagatgttcaacatgctaccgtt
tggacatcgaatcgtaaaaatttaacgaaaagtggttgggcgagaaatggcgcatcacgc
ttgtaccatcataaatttggctttggaatattagatgcagcagcattagttgatattgtt
gatcctaaggtatggaaaaccgtacctgagcaaaagttttgtcctttgacagctgataaa
atagaaagagaaatctccagtgaaggaattgtacgaatccaaattaaaagtcatggatgc
caggactccaaagatagtattaattatttggaacatgttcaactcatatctacaattgat
ttttcgcggcgtggagatttagacattactctaatctcgccaagtggtacaagatcgaat
ttattaagtagaagacttcgtgattcatccgcatctggatttaacagttggccatttatg
tcaactcatttctggggtgaaaatccaagaggtacttggaccgttgaaattaaaaatgtc
ggcatgacgaatgaacacggtttcgttcgagaaaccatgttagtattttatggaacagaa
actatgcctgatgttatgcgtcgtgttttatcgaaagatgatgtgaaattaactagtaat
catcagtcatcacaaagtcatcatggtgaggtaatgaaaggaaaaattcatgaggaaggt
cattttggatctaatttgaatcaagctgaacataatagcaatatcaacgaacacatcttc
gataaacatgagggtaatagatatgaccatctcgaaaagaacgacgttcacccattgcat
cgatctttccataagaaatattcaggtgattctgatatgccagcacatcttttacgatac
tatgcccaaatattaaagcgaaaaaatagaaacaactattcaaagcgatcaaagttgtac
cgttatcagcgtgatttttaa

DBGET integrated database retrieval system