KEGG   Trichoplax adhaerens: TRIADDRAFT_23343Help
Entry
TRIADDRAFT_23343  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
tad  Trichoplax adhaerens
Brite
Enzymes [BR:tad01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     TRIADDRAFT_23343
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 312 aa AA seqDB search
MSVNYAENLSHYPNKGKCGQAEIFDSTEVLQSKIKQLAEMIKASKYIVVHTGAGISTSAG
IPDFRGPRGVWTLEEKGKKPEINITFETAQPTLTHMAVVELARAGIVKYVISQNVDGLHW
KSGLPRNKVSELHGNMFVDRCDRCYQEYCHAHASVTVGCKKTGTRCTRNDRCRGYIRDTI
LDWEDSLPEKDLLSAEDHLRRSDLSLCLGTSLQIKPSGDLPLLTLKNNGCIAICNLQPTK
LDKKASLCIHGYVDQVMIGVMDELGLPIPKYSPMITENLLKRKFDCIKEERLVDGEPDNK
KALTNHKRPSGC
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtaaactacgcagaaaatctatctcattatccaaacaagggtaaatgtggccaa
gccgagatatttgattccactgaagtactacaaagtaaaattaaacaactggcagaaatg
attaaagccagcaagtatattgtagtacatactggtgcaggtatcagcaccagtgctgga
atacccgattttaggggccctcgaggcgtatggacattagaggaaaaaggcaaaaaaccg
gaaataaatattacattcgaaactgctcaacctactttaacacatatggcagtagtcgaa
ctagccagagctggcattgtgaaatatgtaattagtcagaacgttgacggtttacattgg
aaatctggcctcccaagaaacaaagtatcggaactccatggaaacatgtttgttgataga
tgtgatagatgttatcaagaatactgtcatgctcatgcctcagttaccgttggatgtaag
aagacaggcacaagatgcactcgtaacgatcgatgcagaggctatataagagatacaata
ttagattgggaagattctcttccagaaaaagacctactctcagctgaagatcatctaagg
cgatctgatttatctttgtgtttgggtacttcactccaaattaaaccgagtggagacttg
cctctgctaacgttaaagaacaacgggtgcatagcgatttgtaatctacaaccgacaaaa
ttggacaaaaaagcgtcattatgtatccatggctatgttgatcaagtgatgatcggtgtt
atggacgaattgggtttaccgataccaaagtattcaccaatgataacagaaaatctatta
aaaaggaaattcgattgtatcaaggaagagaggctcgtggatggagaacctgataataaa
aaagctctcaccaatcacaagcgtccgtccggatgctaa

DBGET integrated database retrieval system