KEGG   Trichoplax adhaerens: TRIADDRAFT_2382Help
Entry
TRIADDRAFT_2382   CDS       T01069                                 

Definition
hypothetical protein
Orthology
K14459  
hexosaminidase [EC:3.2.1.52]
Organism
tad  Trichoplax adhaerens
Pathway
Other glycan degradation
Brite
KEGG Orthology (KO) [BR:tad00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    TRIADDRAFT_2382
Enzymes [BR:tad01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     TRIADDRAFT_2382
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 373 aa AA seqDB search
ERKFPGHRVIHLDLKGAPPKMTYYKKLFPFLRSLGATGVLIEYEDMFPYKDNLKVLARTD
AYTESEVNAIVQLAEEFKLLVIPLIQTFGHLEFMLKHQQFKHLRALSTSKKALCPCQNSS
LPILLDMAKQVIALHPNTKYLHIGGDEIYDLMKCTKCKALAYKKHDMYLLHMVPLLTEIK
SSWPELTVLMWDDMLRSWSVDQMLTLQNLATPMVWAYEENLSKYFPQTMWKNYKQVFGSV
WIASAFKGALRKDTDIVPLNKHIENQLQWLKIISNLDGMEIPGIAITGWSRFDHFSPLCE
LLPAGLPSLALCLTALDRGSVNPEVIHTVSVDALGCAGKIYDDSSGTYQVQKCGFPGSDV
FLIVSRLDLLRNE
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
gaacgcaaatttcctggacatagagtcatccatttagatttaaaaggagctcctcctaag
atgacctattataaaaagctctttcctttcttgcgttcgcttggtgctacaggagtactc
attgagtatgaagatatgtttccgtataaggataatttaaaagttttagctcgtactgac
gcttacacggaaagcgaagtcaatgcaattgtccaacttgctgaagaatttaaacttctt
gtaattcctttaatccaaacttttggccatctagaatttatgttaaagcatcaacaattt
aaacatttacgtgctctcagtacttccaagaaggcgctatgcccttgccaaaattcttcc
ttaccaatattgctggatatggcaaaacaggtcattgccttgcatcccaataccaaatat
ttgcacattggtggtgacgaaatctacgacttaatgaaatgtaccaagtgtaaagcatta
gcttataaaaaacatgacatgtatttattacatatggtgccgctacttacagaaattaaa
tcatcttggcctgagttaactgttctgatgtgggatgatatgttgcgctcatggtctgta
gatcaaatgttgacgctacaaaatttagcaacccccatggtttgggcttatgaagaaaac
ttgtctaaatactttcctcagacgatgtggaaaaactacaagcaggtatttggatcagtg
tggatagcgagtgctttcaaaggcgcattgagaaaagatacggatatcgttccactcaat
aagcatattgaaaatcagttacagtggttaaaaattatatccaacttagatggtatggaa
attcctggcattgctataactggttggtcaagattcgatcatttttctccactatgtgaa
ttactaccagcaggtcttccatcattagccttgtgcttgacagctttggatcgaggtagt
gtaaatcctgaggtcatacatactgtatctgtagatgctttgggttgtgctggtaaaatt
tatgatgacagctctggtacttatcaagtccaaaaatgtggatttcctggcagtgatgta
ttcctcattgttagtcgcttagatttattacgtaacgaa

DBGET integrated database retrieval system