KEGG   Trichoplax adhaerens: TRIADDRAFT_24973Help
Entry
TRIADDRAFT_24973  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
tad  Trichoplax adhaerens
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Peroxisome
Brite
KEGG Orthology (KO) [BR:tad00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    TRIADDRAFT_24973
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    TRIADDRAFT_24973
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    TRIADDRAFT_24973
Enzymes [BR:tad01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     TRIADDRAFT_24973
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 363 aa AA seqDB search
NSKIPLYQWIFQQMKYDSEGVKFLIDCRAALLDHVRKNKNFGSIEIPAMEKSLKSILREY
FATEHLKVRTVRKDDDKDLKEKLIEYEAVHAYRDDNDLEQRIGLNRRCFILTHNQLPGEP
LAILHTELTDKTTGNIHDIIDRSTNEKERIERILVAIFYSVSVTNKGLSGFQFGQYIIKK
AVGQLQEEFPRLREFFTLSPIPGFRKWLLNELQSQYFGLMQRIQNTLNKDGVAMNVPGML
EDWQADKESVIIQGLKETLLPLCACYLTLERNRNRAINPVANFHIGNGACIYRLNWLADL
TNNGMQSSFGIMVNYQYILKEMQYHTQRYYEHGQIGVSNSIHDYIEGSCPVNKPYYIARK
SKL
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
aacagcaaaataccattgtatcaatggattttccaacaaatgaaatacgatagtgaaggt
gttaaattccttatagactgtagagctgccttgcttgatcatgtgcgtaaaaataaaaac
tttggaagtatcgaaattcctgcaatggaaaaatcccttaaaagtattcttagagagtac
tttgctacagagcatctaaaagtacggactgtaagaaaagatgatgacaaagacttaaag
gaaaagttaattgaatatgaagctgttcatgcgtatcgagatgataacgatcttgaacaa
agaataggattaaataggcgttgcttcatactaacacacaaccagttacctggagagcca
ttggcgattttacatacagagttaaccgataaaaccaccggaaatattcatgacattata
gacaggtcaactaatgagaaagaaagaatagaaagaattttggtagccatattttattcc
gtttctgtaacaaataaaggattgtcaggatttcaatttggacaatatataattaagaaa
gcggttggacagttacaggaagaatttcctcggctacgggaattctttacgttatcccca
attccaggctttcgaaagtggctattgaatgaattacagtcacaatattttggcttaatg
caacgtatccaaaacacattaaacaaagatggtgtggctatgaatgtacctggaatgtta
gaggattggcaagctgataaagaatcagtaattatccaaggactaaaagaaacgctatta
cctctgtgtgcttgttacttaacgttagaaagaaatagaaaccgtgccattaatccagtt
gcaaatttccacattggaaatggtgcgtgcatatacagattaaattggctagcagacttg
accaataacggaatgcaatccagttttggaattatggttaattatcagtatatactgaaa
gaaatgcagtatcatacgcagcggtattatgaacatggtcaaattggcgtctctaatagt
atccacgactatatcgaagggtcttgtccagttaataaaccttactatattgcgcgtaaa
agtaaattatag

DBGET integrated database retrieval system