KEGG   Trichoplax adhaerens: TRIADDRAFT_25064Help
Entry
TRIADDRAFT_25064  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K11844  
ubiquitin carboxyl-terminal hydrolase 16/45 [EC:3.4.19.12]
Organism
tad  Trichoplax adhaerens
Brite
Enzymes [BR:tad01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     TRIADDRAFT_25064
Peptidases [BR:tad01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   TRIADDRAFT_25064
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 225 aa AA seqDB search
MTGENKYHCKFCTRKQGKPIEDKSTGKSSTKEAQDEPFLDVFKQEDKKFAPVYTVSTAQM
LICELPKVVVLNLKRFEHVGASFRKLAKHITFPLQLDMLPFCTDDCKVRGGSNSTGLYEL
FGVVVHIGRLGGGHYSAYVKARTSQSDLMSEVTESIEQDDLKESALHDALQKLKECSMTF
KQSDLRCQPGAWYHVSDLHVSKASENQVLKAQAYILFYKRLFVKG
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgactggcgaaaacaaatatcattgcaagttttgtacaagaaagcaaggaaaaccaata
gaagataagtcgactggtaaaagcagcaccaaagaagcacaagatgagcctttcctcgat
gtgtttaagcaagaagataagaaatttgcaccagtgtatacggtatcaacagcccaaatg
cttatttgcgaattgcctaaagtagtagttctaaacctgaagcgttttgagcatgttgga
gcatcgtttagaaagttagcaaaacacattacattcccgttacagttagacatgttgcct
ttttgcaccgatgattgcaaggttcgaggtggcagtaattctactggattatacgaatta
ttcggtgttgtcgtgcatatcggtcgactaggcggcggccattattctgcttatgttaag
gctagaacaagccaatcagatctgatgtcagaagttacagaatccatagagcaagatgat
ttaaaggaatctgcactacatgatgcattacaaaagttaaaagaatgcagcatgactttc
aagcaatccgatcttcgttgtcaaccaggtgcttggtaccacgttagcgatctacatgta
tcgaaagcttctgaaaatcaggtcttaaaagctcaagcttatattctattctataaacgt
ttatttgttaaaggctaa

DBGET integrated database retrieval system