KEGG   Trichoplax adhaerens: TRIADDRAFT_25064Help
Entry
TRIADDRAFT_25064  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K11844  
ubiquitin carboxyl-terminal hydrolase 16/45 [EC:3.1.2.15]
Organism
tad  Trichoplax adhaerens
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 225 aa AA seqDB search
MTGENKYHCKFCTRKQGKPIEDKSTGKSSTKEAQDEPFLDVFKQEDKKFAPVYTVSTAQM
LICELPKVVVLNLKRFEHVGASFRKLAKHITFPLQLDMLPFCTDDCKVRGGSNSTGLYEL
FGVVVHIGRLGGGHYSAYVKARTSQSDLMSEVTESIEQDDLKESALHDALQKLKECSMTF
KQSDLRCQPGAWYHVSDLHVSKASENQVLKAQAYILFYKRLFVKG
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgactggcgaaaacaaatatcattgcaagttttgtacaagaaagcaaggaaaaccaata
gaagataagtcgactggtaaaagcagcaccaaagaagcacaagatgagcctttcctcgat
gtgtttaagcaagaagataagaaatttgcaccagtgtatacggtatcaacagcccaaatg
cttatttgcgaattgcctaaagtagtagttctaaacctgaagcgttttgagcatgttgga
gcatcgtttagaaagttagcaaaacacattacattcccgttacagttagacatgttgcct
ttttgcaccgatgattgcaaggttcgaggtggcagtaattctactggattatacgaatta
ttcggtgttgtcgtgcatatcggtcgactaggcggcggccattattctgcttatgttaag
gctagaacaagccaatcagatctgatgtcagaagttacagaatccatagagcaagatgat
ttaaaggaatctgcactacatgatgcattacaaaagttaaaagaatgcagcatgactttc
aagcaatccgatcttcgttgtcaaccaggtgcttggtaccacgttagcgatctacatgta
tcgaaagcttctgaaaatcaggtcttaaaagctcaagcttatattctattctataaacgt
ttatttgttaaaggctaa

DBGET integrated database retrieval system