KEGG   Trichoplax adhaerens: TRIADDRAFT_25162Help
Entry
TRIADDRAFT_25162  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
tad  Trichoplax adhaerens
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Lysosome
Class
Metabolism; Overview; Fatty acid metabolism [PATH:tad01212]
Metabolism; Lipid metabolism; Fatty acid elongation [PATH:tad00062]
Cellular Processes; Transport and catabolism; Lysosome [PATH:tad04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 304 aa AA seqDB search
MARALLSRRIFFSITWILLGLTCHTQSSPTPAVLWHGLGDSCCNPLSIGRIQKVIESNVK
GIYVRSLQIGTNFFEDTFNGYFLNANKQIAMVCEKLAKDPKLKHGYNAVGFSQGGQFLRA
VAQRCPNPPMRNFISIGGQHQGVYGFPRCPGNSSELCNLLRQLLNQGVYVPFIQDNVTPA
EYWQDPLNKKEYKQKSVFLADINQERGINATYKKNLMKLSKFVMVKFENDTVVQPKASEW
FGFYKENSTSETFTLQQSRLYKEDWLGLKAMDHAKKLVFLKTEGDHLQFSNKWFIQNIVN
PYLK
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggctagagcgcttctctctcgtaggattttcttctccatcacctggattttgctcggt
ttaacttgtcatacacagtcaagcccaacgcctgctgtcttatggcatggccttggtgac
agctgctgcaacccactgagcatagggcgcattcaaaaagtgattgaatccaatgtcaaa
ggcatctatgtcagatcactacaaattggcaccaattttttcgaggacaccttcaatgga
tatttcttaaatgccaataagcaaattgctatggtgtgtgaaaaattagcaaaagatccc
aagttaaaacacggttataatgctgttggattctctcaagggggacaatttctgagagca
gtagctcaacgctgtcctaacccgcctatgcgtaatttcatctccattggaggacaacat
caaggtgtttatggcttccctcgttgtcctggtaattccagcgaattatgcaatttatta
cgacaacttctgaaccaaggtgtttatgtaccatttattcaagataatgtaacaccagcg
gaatattggcaagatcctctcaataagaaagaatataagcagaaaagtgttttcttagct
gatattaatcaggaaagaggaatcaatgctacttataaaaagaatttaatgaagttatcc
aaattcgtcatggttaaatttgagaatgatactgttgtccagcctaaagcaagtgaatgg
tttggattctataaagaaaattcaacttcggaaactttcactctccaacaaagtcgttta
tataaggaagactggttaggattgaaggccatggatcacgccaaaaagttggtctttctt
aaaactgaaggcgatcatttacagttttctaataagtggtttattcaaaatatcgtcaat
ccctatttaaagtag

DBGET integrated database retrieval system