KEGG   Trichoplax adhaerens: TRIADDRAFT_25844Help
Entry
TRIADDRAFT_25844  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K11418  
histone deacetylase 11 [EC:3.5.1.98]
Organism
tad  Trichoplax adhaerens
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 374 aa AA seqDB search
TNLYIDIRDNQWPIVYSDRYDISFFGVEKLHPFDSCKWGKVMAILKSMKLIGDDDIVIPN
EATENDLLVVHPSSYLKSLKWSITVANIIEVPFVALLPNFVVQKRILKAFRYQTGGTVLA
GKLALERGWAINIGGGFHHCSSDNGGGFCAYADITICLKMLFQHVDGVRKAVIIDLDAHQ
GNGHERDFAYNSNVYILDLYNADIYPRDKDARRGISKEIKIRTGEKDDRYLMLIKLNYPT
ILDEFKPDIVIYNAGTDILDGDPLGGLCISAQGVIKRDEIVFKETRFRNIPIVMLTSGGY
QKSNAKIIADSIMNLYQKKLIGNEYTATFSSGKSVMRPSSVMILQKLHCNRLFHHYFRSE
SRKTVSKGIHLGIS
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
acgaacctatacatcgacattagagataatcaatggcctattgtttatagtgatcgttac
gatatctccttcttcggcgtagaaaaattgcatccattcgattcgtgtaaatggggaaag
gtcatggcaatattaaaatctatgaaattaattggtgacgatgatattgtaattccaaat
gaagcaacggaaaatgacttgctggtagtccatccaagctcttatctgaagagtttaaag
tggagcataaccgtagcaaatataattgaagtaccattcgtagcgttattaccaaacttt
gttgttcaaaaacgtatattgaaagcatttcgatatcagaccggtggaaccgttttggca
ggaaagttagcattagaaagaggatgggctatcaatattggtggcggttttcaccattgc
agcagcgataacggtggtggattttgtgcttatgctgatatcacgatctgcttaaagatg
ctatttcagcacgtagatggcgtaagaaaagctgtaataatagacctagacgctcatcag
ggtaatggccacgaaagagatttcgcttataactctaacgtctatatattggatttatat
aacgcagacatatatcctcgtgataaggatgcaagacgtgggattagtaaggagattaaa
attagaacaggcgaaaaggatgatagatacttaatgctaataaaactaaactatccaact
attttagatgaattcaaaccagatatagtgatatataatgctggtactgatatcttggat
ggagatcctttagggggcttatgtatatctgcgcagggcgtcattaagcgcgatgaaatc
gtttttaaggaaacgcgtttcagaaatattccgattgtgatgctaacttctggtgggtat
cagaaaagtaatgcgaagataattgctgattctataatgaatctatatcaaaaaaagctg
atagggaacgagtatacagctaccttttcttcaggtaagtcagttatgcgaccatcaagt
gtaatgattttacaaaaattacattgtaatcgactatttcatcactattttagatcagaa
tctagaaaaactgtcagtaaaggaatacaccttggaatctcatag

DBGET integrated database retrieval system