KEGG   Trichoplax adhaerens: TRIADDRAFT_25844Help
Entry
TRIADDRAFT_25844  CDS       T01069                                 

Definition
(RefSeq) hypothetical protein
  KO
K11418  histone deacetylase 11 [EC:3.5.1.98]
Organism
tad  Trichoplax adhaerens
Brite
Enzymes [BR:tad01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     TRIADDRAFT_25844
Chromosome and associated proteins [BR:tad03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class IV HDACs
     TRIADDRAFT_25844
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 6754049
NCBI-ProteinID: XP_002112403
JGI: 25844
UniProt: B3RXZ5
AA seq 374 aa AA seqDB search
TNLYIDIRDNQWPIVYSDRYDISFFGVEKLHPFDSCKWGKVMAILKSMKLIGDDDIVIPN
EATENDLLVVHPSSYLKSLKWSITVANIIEVPFVALLPNFVVQKRILKAFRYQTGGTVLA
GKLALERGWAINIGGGFHHCSSDNGGGFCAYADITICLKMLFQHVDGVRKAVIIDLDAHQ
GNGHERDFAYNSNVYILDLYNADIYPRDKDARRGISKEIKIRTGEKDDRYLMLIKLNYPT
ILDEFKPDIVIYNAGTDILDGDPLGGLCISAQGVIKRDEIVFKETRFRNIPIVMLTSGGY
QKSNAKIIADSIMNLYQKKLIGNEYTATFSSGKSVMRPSSVMILQKLHCNRLFHHYFRSE
SRKTVSKGIHLGIS
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
acgaacctatacatcgacattagagataatcaatggcctattgtttatagtgatcgttac
gatatctccttcttcggcgtagaaaaattgcatccattcgattcgtgtaaatggggaaag
gtcatggcaatattaaaatctatgaaattaattggtgacgatgatattgtaattccaaat
gaagcaacggaaaatgacttgctggtagtccatccaagctcttatctgaagagtttaaag
tggagcataaccgtagcaaatataattgaagtaccattcgtagcgttattaccaaacttt
gttgttcaaaaacgtatattgaaagcatttcgatatcagaccggtggaaccgttttggca
ggaaagttagcattagaaagaggatgggctatcaatattggtggcggttttcaccattgc
agcagcgataacggtggtggattttgtgcttatgctgatatcacgatctgcttaaagatg
ctatttcagcacgtagatggcgtaagaaaagctgtaataatagacctagacgctcatcag
ggtaatggccacgaaagagatttcgcttataactctaacgtctatatattggatttatat
aacgcagacatatatcctcgtgataaggatgcaagacgtgggattagtaaggagattaaa
attagaacaggcgaaaaggatgatagatacttaatgctaataaaactaaactatccaact
attttagatgaattcaaaccagatatagtgatatataatgctggtactgatatcttggat
ggagatcctttagggggcttatgtatatctgcgcagggcgtcattaagcgcgatgaaatc
gtttttaaggaaacgcgtttcagaaatattccgattgtgatgctaacttctggtgggtat
cagaaaagtaatgcgaagataattgctgattctataatgaatctatatcaaaaaaagctg
atagggaacgagtatacagctaccttttcttcaggtaagtcagttatgcgaccatcaagt
gtaatgattttacaaaaattacattgtaatcgactatttcatcactattttagatcagaa
tctagaaaaactgtcagtaaaggaatacaccttggaatctcatag

DBGET integrated database retrieval system