KEGG   Trichoplax adhaerens: TRIADDRAFT_26103Help
Entry
TRIADDRAFT_26103  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K11433  
histone-lysine N-methyltransferase SETMAR [EC:2.1.1.43]
Organism
tad  Trichoplax adhaerens
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:tad00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    TRIADDRAFT_26103
Enzymes [BR:tad01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     TRIADDRAFT_26103
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 192 aa AA seqDB search
PVIECNDSCLCSIYCWNRVVQLGSSAKLECFKTQSKGLGVRTTDKLIAGQFVCEYLGQVV
SVHEAKSRFSQSDLTKPNYLLVLREHITNFSNPHILITCIDATKFGNIARFINHSCSPNL
LAIAVRINTNVPHLAFFAKRDIAPNEELTFDYAGGYRDNYKQETSHGIKCLCQSETCFGY
LPYDQMLFDESK
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
cctgtcatagaatgcaacgattcctgtctttgtagcatatattgctggaatcgagtggtg
caactaggttcttctgcaaaattagaatgcttcaaaacccaatctaaaggtttaggtgta
agaactacagacaaattaatagctggtcaatttgtctgtgaataccttggacaggttgtt
agtgtccatgaagctaaaagtagattctctcaaagtgatctcacgaagcctaattatctc
cttgttttaagagaacacattacaaatttttctaatcctcatattttaatcacttgcatt
gatgctactaaatttggtaatattgcccgctttatcaatcactcttgcagtcccaatcta
ttggcaattgctgttcgaatcaacactaatgtgcctcatttggctttttttgctaaaaga
gatattgcacccaacgaagaattaacatttgattacgctggtggttatcgggacaattat
aaacaagaaactagtcacggaattaaatgcttgtgtcagagtgagacatgtttcggatac
ttaccctatgatcaaatgctatttgacgaatcgaagtag

DBGET integrated database retrieval system