KEGG   Trichoplax adhaerens: TRIADDRAFT_26293Help
Entry
TRIADDRAFT_26293  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K00922  
phosphatidylinositol-4,5-bisphosphate 3-kinase [EC:2.7.1.153]
Organism
tad  Trichoplax adhaerens
Pathway
Inositol phosphate metabolism
FoxO signaling pathway
Phosphatidylinositol signaling system
mTOR signaling pathway
Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:tad00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    TRIADDRAFT_26293
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    TRIADDRAFT_26293
   04068 FoxO signaling pathway
    TRIADDRAFT_26293
   04070 Phosphatidylinositol signaling system
    TRIADDRAFT_26293
   04150 mTOR signaling pathway
    TRIADDRAFT_26293
Enzymes [BR:tad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     TRIADDRAFT_26293
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 1023 aa AA seqDB search
MSLAIDFLLPTGLMITLEFSKSITISQMKQQVWERAAAMPFGELMFECPSYHLMFINHRG
EREEMTDESRRLSDIRPFAAIFKFVERVGVPPEKRLDQQIAELIECKLDLSEIPLKVEIE
DCHQSLQELCHEVVTRRANSSEEDRANYLYRPPMSLSQLPSYLEERYEKKGGILITVLYQ
SDDRIDDGCNKHTTSVPHNQTASFVVRQVLKAKAKKGQGNVHQEDYNSYVLKICGRNEYL
ISEVPIHQYKFIRLAMIRDESPIVVLQKRLKLKLKECDLPNEAYTPPPLPKKIDIQTKTV
WDIEAKYSMEFMYISDMNIGDETSMLRIKACLYHGEEPLCPVVQTNDVKASSPIWHELVK
FDIDVADIPRMARLCIALFDKRKSKKARKGDLPIAWVNTMLFDHKGYLKSGDQHLTLWPR
KREMEFEINPRGVIGPRPNYERYTDKHDDVDMEKYGTLSIKFLSYGDKIIYPPFHTARDQ
AAIENLIEGDSLKVMSESEKEALWTFRVKCIDVPRSLPKLLQSLKWNRREEVAQMQALLQ
IWTELQAEDALELLDYKFADKAVREFAVKCLRKLNDDDLFQYLLQLTQALKYEPYLDCAL
SRFLLERALLSRRIGHFFFWYLRAEMHDDAVIIRFSMLLDAYLRSNQSHMKILQRQQCDA
LKQMAILNEEMKEYLDENAHERYKILRNKLEDPKFKSSLCDFYCPLAPTCKAGNLIIHHC
KIMDSKMKPLLLEFENASDQFSLGDRASRKYGEPILIMYKKGDDLRQDALTLQIFKIMEN
IWQEGGLDLRMIPYGTMPTGKETGLIEIVQNSFTLANIHKEIYGNTSGALRKDTLHTWMK
RKSKDSDNFRRAIQEFRSSCAAYCVATYILGVGDRHSDNIMIKENGQLFHIDFGHFLGNF
KYKFGIKRERVPFILTPDFVYIVKNDRDDNNTELSRFTDVCEKAFMLIREKGNMFINLFS
MMVSAGIPELSSIRDIRYLLETLKLSSHEAEALRSFQGKYNDAVRNGWKATLNWVIHNNA
KDN
NT seq 3072 nt NT seq  +upstreamnt  +downstreamnt
atgagtttagccattgattttttactccctactggcctgatgattacgttagaattctcc
aaaagtattactatatcccagatgaaacaacaagtatgggaaagagcagcggcaatgcca
tttggagagttaatgtttgaatgcccatcctatcatttaatgttcatcaatcatcgtggt
gaacgagaggaaatgaccgacgaatccagacgattatccgatattcgaccatttgcagca
atatttaaatttgtcgaaagagttggtgttccaccggagaaaagattagaccaacaaatt
gcagaattgattgagtgtaaattagacttgagtgaaatacctctgaaagtggaaattgaa
gattgtcatcaatctcttcaagaattatgccatgaagttgttacccggcgtgccaatagc
tcagaagaagacagagctaattatctctatagacctccaatgtcattatcacaattgcca
tcgtacttagaagagcgttatgaaaaaaagggcggaatattaattactgtattatatcaa
tcggatgatcgcattgatgacggttgcaataagcatactacttctgtaccacataaccaa
actgcttcatttgtggtacgacaagttctaaaagctaaggctaagaaaggtcaaggaaac
gttcaccaagaagactacaatagttatgtcttaaaaatttgtggccgtaacgaatatctc
atctcagaggttccaatccatcaatataaatttattcgcctggctatgattcgtgatgag
tctcctattgtagtactacaaaaacgattaaaactaaagttaaaagaatgtgatttaccc
aatgaagcgtatactccacctcctctacccaagaaaatcgatatccaaacgaaaactgta
tgggatattgaagccaaatattcaatggaatttatgtatattagcgatatgaatattgga
gacgaaacaagcatgttacggataaaagcctgtctgtaccatggcgaagagccattatgc
cctgtagttcaaacaaatgatgtcaaagcctcatcgccgatctggcatgagctagtcaag
tttgatatcgatgtggctgatataccacgaatggctcgcctctgtatcgctctttttgat
aaacgtaaatctaaaaaagcaagaaagggggatcttccaattgcatgggtaaatactatg
ttatttgatcataaaggatacttaaaatctggtgatcagcatcttacgttgtggccgagg
aaaagagaaatggaatttgaaataaatccgcgtggagtcattggcccaaggccaaattat
gaacgttacacagacaagcatgacgatgtggatatggagaagtatggtacattatctatc
aagtttctatcttatggagacaaaattatctatccacctttccatacggctagggatcag
gccgcaatcgaaaatcttattgaaggtgattctctaaaagttatgtctgaaagtgaaaaa
gaagctttatggacttttcgagtgaaatgcatagatgttccaagatcgttacctaaatta
cttcagtcattgaaatggaatcgtcgagaagaagtcgctcaaatgcaagcactgttacaa
atttggactgaactgcaggcagaagatgccttagagttattagattacaagtttgcagat
aaagctgttagggaatttgcggtaaaatgcttaagaaaactcaatgacgatgatctattt
cagtacctgttgcagcttactcaggcgttaaaatacgaaccctaccttgattgtgctctt
agtcgatttttactagagcgagctcttttaagcagaaggattggacatttcttcttttgg
tatttaagagctgaaatgcatgatgatgccgttataattcgctttagtatgctccttgat
gcttacttacgaagtaatcagtcccatatgaaaatactgcaaagacaacagtgtgacgcc
ttaaagcagatggcaatattaaatgaagaaatgaaagaatatctagatgaaaatgctcat
gaacgttacaagatattaaggaataaactagaagatcctaagtttaaaagtagcctatgt
gacttctattgtccactcgctcctacttgtaaagctggtaatttaattattcatcattgt
aaaattatggactcaaagatgaaaccattgttgctggaattcgagaatgcgtcagatcaa
ttttcacttggtgaccgcgcttctcgaaaatatggtgaaccaattttgatcatgtataag
aaaggagatgatctacgtcaagatgcacttacattgcaaatttttaaaattatggaaaac
atttggcaagagggcggtttggatcttagaatgattccttacggcaccatgcccaccggt
aaagaaacaggattaatagaaattgttcagaattcttttacattggctaatattcataaa
gaaatttatggtaatacttctggtgcattacgaaaagatacattgcacacctggatgaag
aggaagagtaaagattcagacaattttcggagagctatacaagaattccgttcatcttgt
gccgcatattgcgtagctacttacattttaggggttggtgatcgtcacagtgataatatt
atgattaaagagaatggtcaacttttccatatagattttggccactttttggggaatttc
aagtataaatttggtatcaaacgtgaacgggtcccatttattttaacaccagatttcgtg
tatatagttaagaatgatcgagacgacaataataccgagttatcaaggtttactgatgta
tgtgaaaaggcatttatgctaatcagagaaaaaggaaatatgtttatcaatttatttagt
atgatggtatctgcgggaattccggaattaagcagtatacgtgatattcgctatttacta
gaaacattaaagctatctagccatgaagcagaggcccttcgaagctttcagggcaaatat
aatgatgctgtaagaaatggttggaaagcaaccctaaactgggttatccacaacaatgcc
aaagataactag

DBGET integrated database retrieval system