KEGG   Trichoplax adhaerens: TRIADDRAFT_26667Help
Entry
TRIADDRAFT_26667  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
tad  Trichoplax adhaerens
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:tad00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    TRIADDRAFT_26667
Enzymes [BR:tad01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     TRIADDRAFT_26667
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 327 aa AA seqDB search
MSGKRVCYFYHPFTWCTSLDQDHPIHPMRIQLTYDLILEYGLHHKMKMLRPQAASLRQLN
RFHSMAYLQFLQRAEESSKREKVQNFGVDDNYPVFQGLLHYCQLVASASVSAASKLNSNQ
ADIAINWSGGFYQAQTSQACGFNYINDVALALLELLKQHERVIYINLGPDQCDTIQEAFS
TNNRVMIVTFPHCESKYFQGNDWINQIGFNQSSKYSLNIPLADNIDDETYGLIFQPIISK
VVQCYQPKVIVLQSGESLIAEKYANGYHLTPQGHGGCLQFLKSFNMPILLLGGGNYSTKN
ISHRWVYGTAIAIGQDISNITPCNNWF
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgagtggaaaacgagtttgctacttttaccatccatttacatggtgtacaagtcttgat
caagatcatcccatccatccgatgagaatacagttaacttacgacttaattcttgaatac
ggattacaccataaaatgaaaatgttacgaccgcaagccgctagtttgcggcaactcaat
cgtttccattcgatggcctacttacaatttttacaacgagcagaagaaagttccaaacgg
gaaaaagttcaaaatttcggtgttgacgataactatccggtatttcaagggcttttgcat
tattgccagttagtagctagtgcttctgtatcagctgcctctaaactgaattctaaccaa
gccgacatcgctattaattggtcaggtggattctatcaagctcaaactagccaagcctgc
ggttttaattatatcaatgatgttgcattagcactattagaactattaaaacaacatgaa
cgtgtaatctatatcaatcttggacctgatcaatgtgatacaatccaagaggcattttct
acaaataatcgtgttatgattgttactttccctcattgcgaaagcaaatattttcagggt
aatgattggataaaccaaattggatttaatcaaagcagtaagtattctttaaatattcct
cttgcggataatatcgatgacgaaacttacggtttaatttttcaaccaataatttccaaa
gtcgtacaatgctatcagccgaaagttatcgtcttacaatccggtgaaagtttaatagct
gaaaaatatgctaatggctaccatttaacaccacagggacatggtggctgccttcaattt
ttaaaatcttttaatatgcctatcctcctattgggaggtggtaattatagtactaaaaat
atttctcaccgctgggtctatggaacggctattgctattggccaagatatatctaatata
actccatgcaataactggttt

DBGET integrated database retrieval system