KEGG   Trichoplax adhaerens: TRIADDRAFT_27464Help
Entry
TRIADDRAFT_27464  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
tad  Trichoplax adhaerens
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:tad01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:tad00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:tad00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:tad00640]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 680 aa AA seqDB search
MVDIADIEKSALGPVYPPSPRVVAEAHVKSMEEYRKMYDRSINDPVAFWGDIAKQFYWKG
APEGRVFDYNFSKSNGRIFIKFMEGIKTNVCYNVIDRNIENGLGDNVAFYWEGNEPGDDS
KVTYSELKRRVCQFANVLKAKGVKKGDHVAIYMPMILELPIAVLACARIGAPHSVVFGGF
SAESLVDRILDSKCCLLVTADGLYRGKKLIELKSIADQAFQILKDRNYSLKCCIVVRHLL
EDLDKKGPQEPPKRPSNIGWNEELDCWWHEEVANVSDECEPEWLDAEDPLFLLYTSGSTG
KPKGVVHTQAGYLLYAATTFKYSFDYHHGDVYFCTADVGWITGHSYVVYGPLANGAPSIV
FEGLPVYPDAGRYWDIVDKYKVSKFYTAPTAIRSLMRFGPDYVKKYSRKTLKVLGSVGEP
LNPEAWRFYYEVIGNGECSISDTFWQTETGGHVLTPLPGCTPMKPGSVCFPFFGIKPVVL
NEDGNEVQGQSEGYLAISQAWPSTMRTVYGDHERYENTYFGKFDGYYCTGDGCFRDKDGY
FWITGRIDDCINVSGHLTSTAQVESALIEHDLVAEAAVVSYPHEIKGQCLYAFLTLIKGA
EFSDEVVVQLKQQVRQKIGSIAVPDYIQDAPGLPKTRSGKIMRRVLRKIARNDHQLGDIS
TMADSSIIETLFQLRPASLK
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atggtagacattgcagatattgaaaaatcagccttgggaccggtttatcctccaagtcca
agagttgttgctgaagctcatgttaagagcatggaggaatatcgtaagatgtatgatagg
agtatcaacgatccagttgctttttggggcgatatagctaaacaattctattggaaaggt
gcaccagaaggcagagtattcgattacaactttagtaaaagtaacggcagaattttcatc
aagtttatggagggtatcaaaaccaacgtctgttataatgttattgatcgcaatattgaa
aatggccttggtgataacgttgctttctactgggaaggaaacgaaccaggtgacgactct
aaggttacctatagtgagctaaaacgccgagtttgccaatttgccaacgttctaaaggct
aaaggtgtcaagaaaggtgaccacgttgctatctatatgcccatgatacttgaactacca
atagctgtcttggcatgtgcaagaattggtgcaccacactctgttgtgtttggtggattt
tcagcggaatcactagttgatagaatactggattcgaaatgttgtctccttgtcactgca
gacggtttatacagagggaagaaattaatagaactgaagagtattgctgatcaggctttc
caaattctgaaagataggaattactcgttaaaatgctgcatagttgtcagacatttgtta
gaggatttagacaaaaaaggacctcaggaaccaccaaaacgaccatcaaatatcggatgg
aatgaagaattagattgttggtggcatgaagaagttgccaatgtttcagatgaatgcgaa
cctgagtggctcgatgccgaagatcctttatttcttttatatactagtggatcgactggc
aaacctaagggagttgttcatactcaagccggttaccttttatatgctgcgacaacattt
aaatattcatttgattatcatcatggagatgtctacttctgtactgctgatgttggttgg
attactggacatagttacgtcgtttatggccctctcgctaacggtgccccaagtattgtg
tttgaaggattgcccgtatacccagatgctggtcgctactgggatattgtagacaagtat
aaagtttctaaattttatactgctccaacagcaattcgttccctcatgagatttggtcct
gattatgtgaaaaagtacagtcgtaagacattaaaggtgcttggatctgtgggagaacct
cttaatccggaagcttggcgtttctattatgaagttattggtaatggagaatgctctatt
tctgatacgttttggcagaccgaaacaggtgggcatgttcttaccccacttccaggttgt
acacccatgaagcctggatctgtgtgtttcccattctttggtatcaagccggtcgtttta
aatgaagatggcaatgaagtacaagggcagagtgaaggatatctggctattagccaggca
tggccaagtaccatgcgtacagtttacggtgaccatgagcgctatgaaaatacatatttt
ggaaaatttgatggatattattgcactggcgatggttgctttagagataaggatggatat
ttttggattactggacgtattgatgattgtattaatgtatctggtcacttaacaagcact
gctcaagttgaaagtgcattaatcgagcacgatctcgtagcagaagctgctgtggtttct
tatccacacgaaatcaaaggtcaatgcttatacgcatttctaaccctaataaagggagct
gaatttagtgatgaagtagtcgttcaacttaagcaacaagtacgacaaaagattgggtct
atcgctgtaccggattacattcaagatgcccctggattacctaaaactcgttcgggaaag
attatgcgccgcgttttgagaaagattgctcgtaatgatcaccaattgggtgatatttct
acaatggcagattcgtcaatcattgaaactctattccagttgcgcccggcttctctgaag
tga

DBGET integrated database retrieval system