KEGG   Trichoplax adhaerens: TRIADDRAFT_27464Help
Entry
TRIADDRAFT_27464  CDS       T01069                                 

Definition
(RefSeq) hypothetical protein
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
tad  Trichoplax adhaerens
Pathway
tad00010  Glycolysis / Gluconeogenesis
tad00620  Pyruvate metabolism
tad00640  Propanoate metabolism
tad01100  Metabolic pathways
tad01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tad00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TRIADDRAFT_27464
   00620 Pyruvate metabolism
    TRIADDRAFT_27464
   00640 Propanoate metabolism
    TRIADDRAFT_27464
Enzymes [BR:tad01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     TRIADDRAFT_27464
Lipid biosynthesis proteins [BR:tad01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   TRIADDRAFT_27464
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-GeneID: 6755251
NCBI-ProteinID: XP_002114358
JGI: 27464
UniProt: B3S2N4
AA seq 680 aa AA seqDB search
MVDIADIEKSALGPVYPPSPRVVAEAHVKSMEEYRKMYDRSINDPVAFWGDIAKQFYWKG
APEGRVFDYNFSKSNGRIFIKFMEGIKTNVCYNVIDRNIENGLGDNVAFYWEGNEPGDDS
KVTYSELKRRVCQFANVLKAKGVKKGDHVAIYMPMILELPIAVLACARIGAPHSVVFGGF
SAESLVDRILDSKCCLLVTADGLYRGKKLIELKSIADQAFQILKDRNYSLKCCIVVRHLL
EDLDKKGPQEPPKRPSNIGWNEELDCWWHEEVANVSDECEPEWLDAEDPLFLLYTSGSTG
KPKGVVHTQAGYLLYAATTFKYSFDYHHGDVYFCTADVGWITGHSYVVYGPLANGAPSIV
FEGLPVYPDAGRYWDIVDKYKVSKFYTAPTAIRSLMRFGPDYVKKYSRKTLKVLGSVGEP
LNPEAWRFYYEVIGNGECSISDTFWQTETGGHVLTPLPGCTPMKPGSVCFPFFGIKPVVL
NEDGNEVQGQSEGYLAISQAWPSTMRTVYGDHERYENTYFGKFDGYYCTGDGCFRDKDGY
FWITGRIDDCINVSGHLTSTAQVESALIEHDLVAEAAVVSYPHEIKGQCLYAFLTLIKGA
EFSDEVVVQLKQQVRQKIGSIAVPDYIQDAPGLPKTRSGKIMRRVLRKIARNDHQLGDIS
TMADSSIIETLFQLRPASLK
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atggtagacattgcagatattgaaaaatcagccttgggaccggtttatcctccaagtcca
agagttgttgctgaagctcatgttaagagcatggaggaatatcgtaagatgtatgatagg
agtatcaacgatccagttgctttttggggcgatatagctaaacaattctattggaaaggt
gcaccagaaggcagagtattcgattacaactttagtaaaagtaacggcagaattttcatc
aagtttatggagggtatcaaaaccaacgtctgttataatgttattgatcgcaatattgaa
aatggccttggtgataacgttgctttctactgggaaggaaacgaaccaggtgacgactct
aaggttacctatagtgagctaaaacgccgagtttgccaatttgccaacgttctaaaggct
aaaggtgtcaagaaaggtgaccacgttgctatctatatgcccatgatacttgaactacca
atagctgtcttggcatgtgcaagaattggtgcaccacactctgttgtgtttggtggattt
tcagcggaatcactagttgatagaatactggattcgaaatgttgtctccttgtcactgca
gacggtttatacagagggaagaaattaatagaactgaagagtattgctgatcaggctttc
caaattctgaaagataggaattactcgttaaaatgctgcatagttgtcagacatttgtta
gaggatttagacaaaaaaggacctcaggaaccaccaaaacgaccatcaaatatcggatgg
aatgaagaattagattgttggtggcatgaagaagttgccaatgtttcagatgaatgcgaa
cctgagtggctcgatgccgaagatcctttatttcttttatatactagtggatcgactggc
aaacctaagggagttgttcatactcaagccggttaccttttatatgctgcgacaacattt
aaatattcatttgattatcatcatggagatgtctacttctgtactgctgatgttggttgg
attactggacatagttacgtcgtttatggccctctcgctaacggtgccccaagtattgtg
tttgaaggattgcccgtatacccagatgctggtcgctactgggatattgtagacaagtat
aaagtttctaaattttatactgctccaacagcaattcgttccctcatgagatttggtcct
gattatgtgaaaaagtacagtcgtaagacattaaaggtgcttggatctgtgggagaacct
cttaatccggaagcttggcgtttctattatgaagttattggtaatggagaatgctctatt
tctgatacgttttggcagaccgaaacaggtgggcatgttcttaccccacttccaggttgt
acacccatgaagcctggatctgtgtgtttcccattctttggtatcaagccggtcgtttta
aatgaagatggcaatgaagtacaagggcagagtgaaggatatctggctattagccaggca
tggccaagtaccatgcgtacagtttacggtgaccatgagcgctatgaaaatacatatttt
ggaaaatttgatggatattattgcactggcgatggttgctttagagataaggatggatat
ttttggattactggacgtattgatgattgtattaatgtatctggtcacttaacaagcact
gctcaagttgaaagtgcattaatcgagcacgatctcgtagcagaagctgctgtggtttct
tatccacacgaaatcaaaggtcaatgcttatacgcatttctaaccctaataaagggagct
gaatttagtgatgaagtagtcgttcaacttaagcaacaagtacgacaaaagattgggtct
atcgctgtaccggattacattcaagatgcccctggattacctaaaactcgttcgggaaag
attatgcgccgcgttttgagaaagattgctcgtaatgatcaccaattgggtgatatttct
acaatggcagattcgtcaatcattgaaactctattccagttgcgcccggcttctctgaag
tga

DBGET integrated database retrieval system