KEGG   Trichoplax adhaerens: TRIADDRAFT_28018Help
Entry
TRIADDRAFT_28018  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K01556  
kynureninase [EC:3.7.1.3]
Organism
tad  Trichoplax adhaerens
Pathway
Tryptophan metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tad00001]
 Metabolism
  Amino acid metabolism
   00380 Tryptophan metabolism
    TRIADDRAFT_28018
Enzymes [BR:tad01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     TRIADDRAFT_28018
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 457 aa AA seqDB search
MDEAASHGYDIASCEFAQYLDSQDKFKEFRELFYIPRKKTLPLIDLSLVDGESESIYLLG
NSLGLQPKQTRQRLIEHLDKWAEMGIEGQFHGNDRWVDFQDTMTKDLLCPIVGAKPIEIC
VMNAVTVNIHLLMISFYQPTAERCKILIEDGAFPSDHYAVQSQIRMRGYDPDDAMIIVKA
RDGETTIRTEDVIAKINEFGDSIAMILLPGVQFYTCQLFDIKEITKAAHDKGCNIGWDLC
HAAGAVELKLHEWDVDFAVWCSYKYLNSGPGSVSACFVHEKHAHRKDFNRLEGWFGHRLE
TRFDMSNVMESIPGASGFQISNTPVAEVVKLVSSLDIYSRVSLPKLFEKARKGVIYMEAL
YRHYFMNNATSTDCKKVETVADIISPTDPFGRGNHLAFKFSGGVDYVCDGLAKRGIVVDV
RRNEVIRASFAPLYNSFQDVYTFITTLHDLFTQGKKS
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atggatgaagctgctagtcatggctatgacattgctagttgcgagtttgctcaatatctg
gatagtcaagacaaattcaaggaatttcgagagttattttatattccacgaaagaaaact
ttgcctctaattgatttatccttggtcgatggtgagagtgagagtatctatcttcttggt
aattctctcggcttacagcccaagcaaactcgacagcgtttaatagaacacctggacaaa
tgggctgaaatgggtatcgaaggacaattccacgggaatgatcgctgggttgactttcag
gatacgatgactaaggatttgctatgtcctattgttggagctaagcctattgaaatctgc
gtaatgaatgcagttactgttaacattcacctgctaatgatatctttttatcaacctact
gccgaaagatgcaagattcttattgaagacggagcattcccttctgatcattatgcagtc
caatcacagatacgaatgcgtggttatgatccagatgatgcaatgataatagtaaaagca
cgagatggagaaactactataagaacggaagatgtaatagccaagataaacgaatttggt
gattctattgctatgattttattacctggagtgcaattttatacttgtcagttgtttgat
attaaagaaattactaaggcagcacacgataaggggtgcaatataggttgggatttatgt
catgcggctggtgccgttgaattaaaattacatgaatgggacgttgattttgctgtttgg
tgctcttataagtacctaaatagcggtccaggatcggtttcagcatgttttgtacatgaa
aagcatgcacatcggaaagattttaatagacttgaaggctggttcggtcatcgtttagaa
accagatttgatatgtcaaacgtcatggagagtattcctggcgcatcgggctttcaaata
tctaatacacctgttgctgaagttgttaaactcgttagtagtttagatatctactcaaga
gtatcactaccgaagctatttgaaaaagctcgcaaaggtgtgatatatatggaagcactt
tataggcattactttatgaataatgccacatcgactgactgtaagaaagtagagactgtt
gcggatattatttcacctactgatccttttggaaggggcaatcacttagcattcaaattt
tcgggtggcgttgattatgtttgtgacggactggcaaaaagaggaatcgttgtggatgtt
cgaagaaatgaagttattagagctagtttcgctccattgtataattcattccaggacgtt
tacacctttataactactttacatgacctgtttactcaaggaaagaagtcataa

DBGET integrated database retrieval system