KEGG   Trichoplax adhaerens: TRIADDRAFT_28018Help
Entry
TRIADDRAFT_28018  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K01556  
kynureninase [EC:3.7.1.3]
Organism
tad  Trichoplax adhaerens
Pathway
Tryptophan metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:tad00380]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 457 aa AA seqDB search
MDEAASHGYDIASCEFAQYLDSQDKFKEFRELFYIPRKKTLPLIDLSLVDGESESIYLLG
NSLGLQPKQTRQRLIEHLDKWAEMGIEGQFHGNDRWVDFQDTMTKDLLCPIVGAKPIEIC
VMNAVTVNIHLLMISFYQPTAERCKILIEDGAFPSDHYAVQSQIRMRGYDPDDAMIIVKA
RDGETTIRTEDVIAKINEFGDSIAMILLPGVQFYTCQLFDIKEITKAAHDKGCNIGWDLC
HAAGAVELKLHEWDVDFAVWCSYKYLNSGPGSVSACFVHEKHAHRKDFNRLEGWFGHRLE
TRFDMSNVMESIPGASGFQISNTPVAEVVKLVSSLDIYSRVSLPKLFEKARKGVIYMEAL
YRHYFMNNATSTDCKKVETVADIISPTDPFGRGNHLAFKFSGGVDYVCDGLAKRGIVVDV
RRNEVIRASFAPLYNSFQDVYTFITTLHDLFTQGKKS
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atggatgaagctgctagtcatggctatgacattgctagttgcgagtttgctcaatatctg
gatagtcaagacaaattcaaggaatttcgagagttattttatattccacgaaagaaaact
ttgcctctaattgatttatccttggtcgatggtgagagtgagagtatctatcttcttggt
aattctctcggcttacagcccaagcaaactcgacagcgtttaatagaacacctggacaaa
tgggctgaaatgggtatcgaaggacaattccacgggaatgatcgctgggttgactttcag
gatacgatgactaaggatttgctatgtcctattgttggagctaagcctattgaaatctgc
gtaatgaatgcagttactgttaacattcacctgctaatgatatctttttatcaacctact
gccgaaagatgcaagattcttattgaagacggagcattcccttctgatcattatgcagtc
caatcacagatacgaatgcgtggttatgatccagatgatgcaatgataatagtaaaagca
cgagatggagaaactactataagaacggaagatgtaatagccaagataaacgaatttggt
gattctattgctatgattttattacctggagtgcaattttatacttgtcagttgtttgat
attaaagaaattactaaggcagcacacgataaggggtgcaatataggttgggatttatgt
catgcggctggtgccgttgaattaaaattacatgaatgggacgttgattttgctgtttgg
tgctcttataagtacctaaatagcggtccaggatcggtttcagcatgttttgtacatgaa
aagcatgcacatcggaaagattttaatagacttgaaggctggttcggtcatcgtttagaa
accagatttgatatgtcaaacgtcatggagagtattcctggcgcatcgggctttcaaata
tctaatacacctgttgctgaagttgttaaactcgttagtagtttagatatctactcaaga
gtatcactaccgaagctatttgaaaaagctcgcaaaggtgtgatatatatggaagcactt
tataggcattactttatgaataatgccacatcgactgactgtaagaaagtagagactgtt
gcggatattatttcacctactgatccttttggaaggggcaatcacttagcattcaaattt
tcgggtggcgttgattatgtttgtgacggactggcaaaaagaggaatcgttgtggatgtt
cgaagaaatgaagttattagagctagtttcgctccattgtataattcattccaggacgtt
tacacctttataactactttacatgacctgtttactcaaggaaagaagtcataa

DBGET integrated database retrieval system