KEGG   Trichoplax adhaerens: TRIADDRAFT_28028Help
Entry
TRIADDRAFT_28028  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K04367  
proto-oncogene serine/threonine-protein kinase mos [EC:2.7.11.1]
Organism
tad  Trichoplax adhaerens
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 294 aa AA seqDB search
MACELFSLISPHWTNSTYAKVDHNELNIERLLGSGGFGSVYEGTYGSKKVAIKKLHQRGK
NERAALDSFKAEVLAMSLLHHPNIVETVAISTASDCLHDYPLLIMELAGSRNLQEVLNDT
DTEVIDVKRRLKFAHQIAMALEYTHSFGIVHLDLKPANVLITPEDNCKLADFGCSQTVQE
DGSCVNSPTRSYLTGTFAYTAPELLRGCDPTTKADIYSFAICLWQLIARERPYGCENPHV
VIFAVVAYNHRPPITTQMEMEEDYQHLVMQGWNACPSDRPTAADCVEVLKKLQQ
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atggcctgtgaattattttcattaatttctcctcattggacaaattcaacgtatgctaaa
gttgatcataatgagttaaacattgaacgcctattaggtagcggcggtttcggttcagtt
tatgaaggtacctacggtagtaaaaaagttgcaattaaaaaactacatcaacgtggtaaa
aatgaacgagcggcattggatagttttaaagcagaggtcctagctatgtcgcttttacac
catcctaacattgttgaaactgtagcgatatcgacagcatctgattgcctacatgattat
ccattacttattatggaattagctggcagtcgtaacttacaggaggtcctcaacgatacc
gatacggaagtgatcgatgtaaaaagacgattaaaatttgctcatcagattgcaatggca
ttggagtacactcactcatttggtattgtgcatttagatttaaagcctgctaacgtcttg
attacacctgaagataattgtaagttagccgattttggatgtagccaaaccgtccaagaa
gatggctcatgcgttaatagcccgacacggtcttacttaactggtacttttgcttataca
gcaccggagttattacgtggttgtgatccaactactaaagctgatatctactcatttgca
atttgtttatggcaattaattgcacgagagcgaccttatggatgtgaaaatccacacgtc
gttatttttgctgtagtggcatacaatcatcgtccaccgattaccacgcaaatggaaatg
gaagaagattaccagcatttagttatgcaaggttggaatgcttgtccatctgatcgtcca
acagcagcagactgtgttgaagtattaaaaaagttacagcaatag

DBGET integrated database retrieval system