KEGG   Trichoplax adhaerens: TRIADDRAFT_28251Help
Entry
TRIADDRAFT_28251  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
tad  Trichoplax adhaerens
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Lysosome
Brite
KEGG Orthology (KO) [BR:tad00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    TRIADDRAFT_28251
  Lipid metabolism
   00062 Fatty acid elongation
    TRIADDRAFT_28251
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    TRIADDRAFT_28251
Enzymes [BR:tad01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     TRIADDRAFT_28251
Lipid biosynthesis proteins [BR:tad01004]
 Fatty acid synthase
  Component type
   TRIADDRAFT_28251
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 285 aa AA seqDB search
MASIASSYPRDDVVAHIEGTRPLVIIHGLFEYSSSLSSLKHMITKAFPKIQIYIPDLFPG
YFSVWTPLWKQVESFNEYLKPIFANTTKNGINLLCFSQGGIICRGILQTASNHTVRNFIS
LSGPLMGQFGGKNFKIIVTWVVNLSTSDTKKSIFYSIYGQKLISIANFWNDPHHQKLYLK
YVTYLTALNNQTCHSSSQVFKSNFLKVKKVILIGGPDDGVITPWQSSQFGFYDKHLKIIY
IKDFIGLRSIDKRNDLHLFTIGGVKHKNWHTNATVFNCCIRPFLK
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcaatagcatcatcctatccaagagatgatgttgttgcccatatcgaaggtact
agaccattagtcatcatccatggtttattcgaatattcctctagcttgtccagcctgaaa
cacatgatcaccaaagcttttccgaagatacagatctatataccggatttatttcctgga
tattttagtgtatggactcctctatggaaacaagttgaatcatttaatgaatatctaaaa
ccaatttttgctaatacaacgaagaatggtattaatctactatgtttttctcaaggcggt
ataatatgccgtggtatactacaaacagcgtccaaccacaccgttagaaatttcattagt
ctgtcggggcctttgatgggccaatttggtggtaagaattttaaaataatagtgacatgg
gttgttaatctctcaacctctgatactaaaaaatcaatcttttacagtatatacggacaa
aaactaatttccatcgctaatttttggaatgatccacatcaccagaagctttatttgaaa
tacgtaacttacctaacagctttgaacaatcaaacatgccatagcagtagccaggtattc
aaatccaatttcctcaaagtaaaaaaagtaatattgataggaggaccggatgatggtgtt
attacaccttggcaatccagccaatttggattttatgacaaacatttgaaaatcatttac
atcaaggattttattggactaagatctatcgataaaaggaacgatctacatttatttact
attggtggtgttaagcataagaattggcatacaaatgcgacagtattcaactgttgtata
agacctttcttaaagtaa

DBGET integrated database retrieval system