KEGG   Trichoplax adhaerens: TRIADDRAFT_28351Help
Entry
TRIADDRAFT_28351  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K01202  
galactosylceramidase [EC:3.2.1.46]
Organism
tad  Trichoplax adhaerens
Pathway
Sphingolipid metabolism
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:tad00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    TRIADDRAFT_28351
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    TRIADDRAFT_28351
Enzymes [BR:tad01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.46  galactosylceramidase
     TRIADDRAFT_28351
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 668 aa AA seqDB search
MGAIHRSRAITWLIVAIFSHLRANGHDYPIDDSVGLGPVFDGIGAISGGGATSRLLVSYP
QSQREQVLDYLFKPNFGASLHTFKVEIGGDGQSTDGTEPSHMHSEDDENYQRGYEWYLMV
QAKKRNPNIKLYGLPWAFPGWVGKGTQDPYKYPLITAKYITKWLMGARKYYNLTIDYVGI
WNERPFNSNYIKELRKTLNENGLEKTKIVAADNHWNDIASAIQNDPELAAVVDIIGAHYP
GTMSPKEASATGKPLWASEDYSTTDNKIGGGCFARIINQNYVNGNMSSTIAWNLVASYYN
GLPYPNDGLMTANEPWSGHYEVASPIWLAAHTTQFAFPGWFYLKRGFGSGHLEKNGSFVT
FIDPTKKKFAIVIEAMSHEHSQCIRPPLPQYSITNQVALFRLQGSLKNLVDKVTLWRTCL
KFNGPSSLFERIGTIPVVNNVIELKIDVDCTYTITNTAGQRKGHYPNPPAGQEFPLPYHD
DFDNYQIASEAKYFADQTGVFEIHNSNTPKHGRVMRQMVFNSPISWCTDAAQPISLIGNS
DWKDITVQTDFLIEKGEGVLIAARIGFGGCNIAFTPGVVLRITIHGYFTLSEDLGGFLTI
HSGKLLTPIGLNTWHTATLTVKGGMAAATFDHKPLFNNIFVGYSEGFAAIGAQSFIPVQF
DNFSVRRS
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atgggagcaatccatcgatctcgagccataacctggcttatcgtggctattttttctcat
ctcagagcaaatggtcatgactaccctatcgatgatagtgttgggctaggcccagtattt
gatggaattggagctatcagtggtggaggtgcaacatctcgtctattggttagttacccc
caaagtcaacgagaacaagttctagattatttgtttaagccaaactttggcgcttcgttg
catacctttaaggtagaaattggaggagatgggcaaagcacggatggaacagaaccatcg
catatgcattcagaagatgatgaaaactatcaacgaggatatgaatggtacttaatggtg
caagcgaaaaagagaaatcctaatatcaaactgtatggtctaccgtgggcttttcctgga
tgggttgggaaaggtactcaagatccctacaaatatccccttattacagcaaaatacatt
accaaatggctcatgggtgcaagaaagtattataacctgacgattgattatgttgggatt
tggaacgagaggccatttaatagcaattatataaaggaattaagaaaaactctaaatgaa
aatggtttggaaaaaactaaaattgtcgcagcagataatcattggaatgatatagcatca
gcaatccaaaatgatcccgaactagcagctgtagttgatataataggagctcactatccg
ggcacaatgtcacctaaggaagcttcggcaactggtaaacctctttgggcgtcagaagat
tacagtactactgataacaaaatcggtggaggatgctttgctaggataattaaccaaaac
tatgtcaatggaaatatgtcaagtacaatagcatggaatcttgttgccagttattacaat
gggctaccgtatccaaatgatggcttgatgactgcaaatgaaccatggtctgggcattac
gaagtcgcaagcccaatttggctagcagctcatacgacacagtttgcttttcctggttgg
ttttatttgaaacgaggatttggatctggacatttagagaagaacggcagttttgttacg
tttatcgatcctactaaaaaaaagttcgcgattgtcattgaagcaatgtctcatgaacat
tctcaatgcattcgacctcctctcccacagtactcgattactaatcaggttgcgttattt
cgattgcaaggatctctgaaaaatttggttgataaagtaacattgtggcgtacttgttta
aaatttaacggaccttcatctttgttcgaaagaattggaacaattccagtagttaataat
gtgatagaactgaagatcgatgtagattgtacgtatacgattactaatactgctggccaa
agaaaaggccactatcccaatcctccagcagggcaagaatttccgctgccttatcatgat
gactttgataattatcaaatagctagcgaagccaaatattttgctgatcaaaccggtgta
tttgaaatacacaatagcaatacgccgaagcatggacgtgttatgcgacagatggttttt
aattcgccgatatcatggtgtacagatgctgcacagccaataagccttatcggtaactca
gactggaaagatatcacagtgcaaacggactttctaatcgaaaaaggcgaaggcgttcta
attgcagcaagaattggttttggtgggtgcaatattgcatttacaccgggagtagtattg
cggatcacaattcatggttattttactctcagtgaagacttaggtggctttcttacaata
cattctggcaaattgctgacacccatagggctgaatacttggcatactgccactttaact
gttaagggaggcatggctgctgctacgtttgatcacaagcccctatttaacaatatcttt
gttggctatagtgaaggcttcgcagctataggcgcacaatcttttatcccggttcaattt
gataattttagtgtacggcgttcataa

DBGET integrated database retrieval system