KEGG   Trichoplax adhaerens: TRIADDRAFT_28470Help
Entry
TRIADDRAFT_28470  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K03259  
translation initiation factor 4E
Organism
tad  Trichoplax adhaerens
Pathway
RNA transport
mTOR signaling pathway
Class
Genetic Information Processing; Translation; RNA transport [PATH:tad03013]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:tad04150]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 157 aa AA seqDB search
KHPLQNQWKLWYIKYDKNKSWEDNMKQIASFDNVEDFWALFNHVVKPSDLKAGCDYCLFK
DNISPMWEDERNKKGGRWLLQLAKDRRKSLDSLWLETLFCLIGEMFGDNGDDICGAYIQI
RGKADKLAIWTTDATHKDRILGIGYTMIVFCFIRVLF
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
aagcacccgctccaaaaccagtggaagttatggtatattaaatacgacaaaaataaaagt
tgggaggacaacatgaagcaaatagcctcctttgataatgtagaagacttttgggcactt
tttaaccatgttgttaagcctagcgacctgaaagctggttgtgattactgcttatttaag
gataatatctcaccaatgtgggaagatgaacgaaataaaaaagggggtagatggctacta
cagctagctaaggatagacgaaagagtttagattctctttggcttgaaactctattttgt
cttattggggaaatgttcggtgataacggtgacgatatttgtggagcttacatccagatt
agaggcaaagccgataagttagcaatctggactacagatgcaactcataaagacagaata
cttggaatcgggtatactatgattgttttctgctttattagagtactattctga

DBGET integrated database retrieval system