KEGG   Trichoplax adhaerens: TRIADDRAFT_28470Help
Entry
TRIADDRAFT_28470  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K03259  
translation initiation factor 4E
Organism
tad  Trichoplax adhaerens
Pathway
RNA transport
mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:tad00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    TRIADDRAFT_28470
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    TRIADDRAFT_28470
Translation factors [BR:tad03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    TRIADDRAFT_28470
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 157 aa AA seqDB search
KHPLQNQWKLWYIKYDKNKSWEDNMKQIASFDNVEDFWALFNHVVKPSDLKAGCDYCLFK
DNISPMWEDERNKKGGRWLLQLAKDRRKSLDSLWLETLFCLIGEMFGDNGDDICGAYIQI
RGKADKLAIWTTDATHKDRILGIGYTMIVFCFIRVLF
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
aagcacccgctccaaaaccagtggaagttatggtatattaaatacgacaaaaataaaagt
tgggaggacaacatgaagcaaatagcctcctttgataatgtagaagacttttgggcactt
tttaaccatgttgttaagcctagcgacctgaaagctggttgtgattactgcttatttaag
gataatatctcaccaatgtgggaagatgaacgaaataaaaaagggggtagatggctacta
cagctagctaaggatagacgaaagagtttagattctctttggcttgaaactctattttgt
cttattggggaaatgttcggtgataacggtgacgatatttgtggagcttacatccagatt
agaggcaaagccgataagttagcaatctggactacagatgcaactcataaagacagaata
cttggaatcgggtatactatgattgttttctgctttattagagtactattctga

DBGET integrated database retrieval system