KEGG   Trichoplax adhaerens: TRIADDRAFT_28803Help
Entry
TRIADDRAFT_28803  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tad  Trichoplax adhaerens
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:tad01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:tad01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:tad00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:tad00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:tad00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:tad00052]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 782 aa AA seqDB search
MESKETREDQQQCDHGTKSNAPTKCIAVITSGGDAQGMNAAVRAAVRMAIYNDARVFAVH
EGYQGLVEGEDFIKEMTWSNFLIVLILKGGTIIGTARCQEFRAKEGRIKAAKNLVGRGIS
NLMVIGGDGSLTGANLFRREWTELLTILIERGEIPENSLIEYPVLNIVGLVGSIDNDFCG
TKMTIGADSALHRILECANAIITTASSHRRTFVLEVMGRRCGYLALISGLAIGADWIFIP
EVPPEDGWEERMCAQLKAARNVGNRLNIIVLAEGAVDIHGNAITAEQVKQILVKYAQQDT
RITVLGHVQRGGSPSAFDRILGCRMGAEAVLSLLESTVDTTPFVIGLQGNDMIRVPLMEC
VEKTRNLAKAMDEHNFEAALDLRNFGNTLSIFKGCNYYSPIPCDQKFRICIMAVGAPAAG
MNAAIRSVTRLSINQGHEVFCIRDGFEGLLSDTDNVQKMEWVTVHDWIAKGGCDIGTKRT
LPSVNMEKIAAGFKKYKFHGLVIIGGFEAFKSATQLLEARNTFEAFAIPIIVIPATLSNN
VPGTDYSLGTDTSLNVIVEVCYHRIRQSATAANHRVFVVETMGGNCGYLATMAGLASGAD
AAYIFEEKYNINDLQGDVAHMIAKFKQDKIHRGLLLTNEFCSRNYDTDFITRLFADEGKE
YFTTRKNVLGHVQQGGYPSPFDRVLSSRFAYAATSFLIREIKNNIRGDGVMNASHPSTVA
LVGSQNRSLRISPVTDLMAVADFDKRIPKQQWWMRLRPLMRILAHHKQTFQRELRPENAD
TE
NT seq 2349 nt NT seq  +upstreamnt  +downstreamnt
atggagagcaaggagacaagggaagatcaacagcaatgcgatcatggcactaagtcgaat
gctcctaccaaatgcattgctgtaattactagtggtggagatgctcagggtatgaatgca
gcagttagagcagcggtgcgaatggctatttataatgatgctcgtgtctttgcagtacat
gagggttatcaaggcttagttgaaggagaagatttcattaaagaaatgacatggtctaat
tttcttattgtactcattctaaaggggggaacaatcattggaactgcccgatgtcaggaa
tttagagcaaaagaaggcagaatcaaagcagctaaaaatcttgttggtaggggcatcagt
aatttaatggtcatcggtggcgatggtagtcttactggagcaaacctttttcgacgggaa
tggacagaactgttgacgatattaattgaaagaggtgaaatacctgaaaacagcctaatt
gaatatcctgtattaaatatcgttggtctggttggctcgatagataacgatttttgtggt
accaagatgaccattggtgccgactctgctttgcataggattcttgagtgcgcaaatgca
attatcactaccgcttcaagccatcgtaggacatttgttcttgaagtgatgggaaggcgc
tgtggctacctagctctaatctccggactcgctattggagcggactggatttttataccc
gaagttccgcctgaagatggatgggaagaacgcatgtgtgctcaattgaaagcagccaga
aatgttggaaatcgcctcaatattattgttttagctgaaggtgcagtagatattcatgga
aatgctatcacagcggagcaagtcaaacagatcttggtaaaatatgcacaacaagatacg
cgtatcactgttttaggacatgttcagaggggtggatcaccctctgcgtttgataggatt
ttaggatgtcgcatgggtgctgaagctgtactgtcgttactcgaatcaacagtcgatact
actcctttcgtcatcggattgcaggggaatgacatgattagggtacctttaatggagtgt
gtcgaaaagactcgcaacttggctaaagcgatggatgaacataatttcgaagccgcgtta
gatttacgaaattttggaaacactttgtcgatatttaaaggttgtaactattacagccca
ataccctgcgaccaaaaattccgcatatgcatcatggctgttggtgctccagctgcagga
atgaacgccgctattagaagtgtgacacgactgtctatcaatcaaggacacgaagtattt
tgtatacgagacggatttgaaggcctcttatctgatacggacaacgtacaaaaaatggaa
tgggtaacagttcacgattggatcgctaaaggtggttgtgatattggtacaaaacgaaca
ctaccgagtgttaacatggaaaagattgcagccggctttaaaaagtataaatttcatggt
cttgtcattatcggtggatttgaggcatttaagagtgctactcagctactggaggctcga
aatacgttcgaagcgtttgcaattccgataattgtcattcctgcaacattaagtaataat
gtaccaggaaccgattattcacttggaactgatacatcacttaatgttattgtcgaggtt
tgctatcacagaattcggcaatcagccactgctgcaaatcatcgcgtatttgtagttgag
acaatgggaggaaattgcggctatttggcgaccatggcaggtctcgctagtggtgctgat
gctgcttatatttttgaagaaaaatataatattaatgatcttcagggtgatgtcgcgcac
atgattgcaaaattcaaacaggataaaatccatcggggattattgttaacgaatgaattc
tgcagccgtaactacgacactgatttcatcacaagattatttgcagatgaaggaaaggaa
tactttacgacaaggaagaatgttttaggacacgtccaacagggcggatatccatcacca
tttgatagagttctgagttcaagatttgcttatgctgctacgtcattcctgattcgagaa
atcaagaacaacattcgcggcgatggggtaatgaatgcttcacatccatctaccgtggct
ctcgtaggctcacaaaacaggagtttaagaatatctcctgttacagatctgatggcagtt
gcagatttcgacaaacgaattccgaaacagcaatggtggatgagattgaggccacttatg
cgcattttagcacatcataaacagacattccagagggaacttcgtccggagaatgctgat
accgagtag

DBGET integrated database retrieval system