KEGG   Trichoplax adhaerens: TRIADDRAFT_28936Help
Entry
TRIADDRAFT_28936  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
tad  Trichoplax adhaerens
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:tad00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TRIADDRAFT_28936
   00052 Galactose metabolism
    TRIADDRAFT_28936
Enzymes [BR:tad01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     TRIADDRAFT_28936
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 315 aa AA seqDB search
MKTSQYHTAHAVFINSKQNSFFYREGNSIDVALGYDGIEGYCKDNVYLGCVVGRVANRIA
KGQFTLDNKQYQLAVNNGPNHLHGGPNGFSKAIWSAEQSTNDSVTFKYVSVDGEESYPGQ
VSVTVTCTLRGSEIILDYAATSLEPTPINLTNHTYFNLGGHDSGDIRNHIIQINSEYYTP
LDDVQIPTGEITSVKGTPFDFMSPKPIGKNMPEGGYDHNFCLAECTGPCIRVTEPNSGRI
LEVFTNQPGVQFYTANYLNGIEGKGGAVYNKHSGFCLETQNYPNAINQDNFPSCVIRPGG
PDYKHRTVYKFCNIN
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgaagacttcacaataccatactgcacatgccgttttcataaacagtaaacaaaactct
tttttttacagagaaggaaattcaatcgatgttgctttaggttatgacggaattgaaggt
tactgtaaggacaacgtatatttgggttgcgtggtcggtcgcgtagctaaccgaattgct
aagggccagtttaccttagataataaacaatatcaacttgctgttaataatggaccgaat
catctccacggagggcctaatggatttagtaaggcgatctggagtgcagagcaatcaaca
aacgatagcgtaacatttaagtatgtgagtgtcgatggtgaagagagttatcctggtcag
gtgtcagtaacagttacatgtacactaagaggaagtgaaattatcttggattatgcagct
acgtcattagaaccgaccccaattaatttgaccaatcatacctactttaatcttggtggc
cacgattccggagatataagaaatcacatcatacaaattaatagcgagtattatactcct
ttggatgatgtgcaaattcctactggtgaaattacttcggttaagggaactccttttgat
ttcatgtcacctaagccaattggtaaaaatatgcccgaaggtggatacgatcataacttt
tgcttggcagagtgtacaggaccttgtattagggtaactgaaccaaacagtgggcgcata
ttagaagtttttacaaatcaaccaggagtgcaattctatactgctaactacctaaatggt
attgagggtaagggtggtgcagtatataataagcattctggattttgtttggaaacacaa
aactatccgaatgcaatcaatcaggacaactttccttcgtgtgtgatccgacctggagga
cctgattacaaacatcgcaccgtttataaattttgcaacataaattaa

DBGET integrated database retrieval system