KEGG   Trichoplax adhaerens: TRIADDRAFT_29177Help
Entry
TRIADDRAFT_29177  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K11540  
carbamoyl-phosphate synthase / aspartate carbamoyltransferase / dihydroorotase [EC:6.3.5.5 2.1.3.2 3.5.2.3]
Organism
tad  Trichoplax adhaerens
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:tad00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:tad00250]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 2200 aa AA seqDB search
MSAVLQLEDGYQMTGTLFGAPISVTGEIVFQTGMVGYPESLTDPSYCKQILVLTYPLIGN
YGVPKEEFDEFGIIKGLESNKIHVAALVIDNLCDEFSHWNANKSLSDWLAENNVPGICDI
DTRELTKRIREKGCMKAKVIVKDDDSSKVPFIDIGSENLVEIVSVKEPKIYNPDGDVSIV
AVDCGIKYNQIRCLVTRGARVKVVPWNYYLDSSEYDGLFLSNGPGDPVRYQATISNVQRI
LNETSPKPVFGICLGHQLMSLAVGGKIIKMRYGNRGHNQPCIHHETGRCFITTQNHGYAV
DKVQSLKDWSVLFTNANDDTNEGIVHDRFPFFSVQFHPEHRGGPQDLEQLFDEFLSIVRD
HKSGKDYSKLSPKIRLHNRFLTNQACGKAQTNAKKVLLLGSGGLSIGQAGEFDYSGSQAI
KALKEEGIYTILVNPNIATVQTSKGLADKVYFLPITPSYVSQIIKSERPDGILLSFGGQT
ALNCGVALKESGVLDQYNIQVLGTSIQSIICTEDRLKFAKKLEEINESIAPSKVAYTVDE
AINAAEALGYPVLVRAAFALGGLGSGFAENKQEMISVAKSAFAHTKQLLIDKSLRGWKEI
EYEVVRDAYDNCITVCNMENVDPLGIHTGESIVVAPSQTLTNEEYNRLRSVAIKTIRHLG
VIGECNIQYAVDPASDKYCIVEVNARLSRSSALASKATGYPLAYIAAKLSLGFSLAALRN
SVTNSTTACFEPSLDYVVVKIPRWDLSKFARVDTKIGSSMKSVGEVMAIGRKFEEALQKA
LRMVDDHCLGFEPESTDVNEEELMFPSNKRIYEIASALRNNYTIDRLHKLTKIDPWFLHR
MKAISEFMVKMSKYKGKLQEIQKSTLSHAKKLGFCDKQIAKYLESTELAVRYKRIDLGIH
PFVKQVDTVAAEYPACTNYLYLTYNGSSHDVKFQNLKHVLVLGSGVYRIGSSVEFDWCAV
NCIRQLRKLGKKTIMVNYNPETVSTDYDECDKLYFDEISFETVMDIYEMEQPEGVILSMG
GQLPNNIAMPLHRQQVKILGTSPEQIDNAENRYKFSRLLDVIKIKQPLWKNLTNMESAEK
FCDEVGYPCLVRPSYVLSGAAMNVASSREELETYLHSAVAVSRDHPVVISKFITEAKEID
VDAVALEGTIVALAVSEHIENAGIHSGDATLVLPPQDLNDETLMKIENITKAIGSALNVT
GPFNLQLIAKDNQLRVIECNLRVSRSFPFVSKTVGHNFVAIATKVMMGIPIEEFVGYQVC
DRIGVKVPQFSFSRLAGSDVMLGVEMASTGEVACFGEDRYEAYLKAMISTGFKIPRKTVL
ISIGSYKSKLEMLRSLQILESLGYKLYGTLGTQDFYAQHNITMEVVEWRFDDLGSEDSSS
LGKYLAQNKFDMVINLPMRSGGSRRVSSFNTLGYRTRRLAVDYSIPLITDIKCAKLLIES
LYRIGGAPSIKTNIDCITSHRCLRLPGLIDVHVHVREPGATHKEDFKTATAAALAGGITA
ICAMPNTNPPVIDIDSFEYTKKLAQQSARCDYALYVGGSTTNAEILPEVGDAAVGLKMYL
NDTYTSLRLDSVADWMKHFENWPTHLPIVAHAEARTTAAVLLLAQIYNRPVHIAHVARKE
EILVIKACKERGMNVTCEVAPHHLFLTEDDAERIGLKRSKVKPQLCSKDDQQALWDNFDI
IDCFATDHAPHTIEEKDSENGPPGFPGLETMLPLLLNAVHQGRLTVEDIVERLYTNPMKI
FNLPEQKDTYIEIDIDESWTIPQLMPQTKSKWTPFAGMQAKGVIRRVVLRGEVAYIDGKV
LAAPGYGKDLKEAQRQPTPGFQHRDHRPQSPVRSDRIPKRIHRLTDGAGNYYIYIISTIG
PSSAPSKFPINLPASSFPSDTEMPFSGSVSISNSDFYGHSIVSVSMFTRENLHTLFNLAH
EMKVATEKYGKINVLANKVMALMFYEVSTRTSSSFTAAMQRLGGSIVSISSKDSSAKKGE
SVEDSVHVMESYCDLVVLRHPEPGIVKRVAAIATKPIINAGDGIGEHPTQALLDVFTIRE
EIGTVNDITITMVGDLKHGRTVHSLARLLSLYRVNLRYVCPPSLKMPDDVISELNGKGIP
QKYFNSIEEALPETDVLYMTRIQAERFPNVEEYEKVFGSHVLTPEVLNHAKEKMAILHPL
PRVNEISIEVDSDPRAAYFRQVEYGMYVRMALLALIVGKN
NT seq 6603 nt NT seq  +upstreamnt  +downstreamnt
atgtcggccgtacttcaactagaagatggctatcaaatgacgggaacactttttggtgca
ccaatcagtgttactggtgaaattgtattccaaactggcatggtcggatatccggaatca
ttaaccgatccttcgtactgtaaacaaattttggttttaacatatcccttaatcggtaat
tatggtgtacctaaagaggaatttgatgagtttggcataatcaaagggctagaatcaaat
aagattcacgtggccgcccttgtcatcgataatctttgcgacgaatttagccattggaat
gctaacaagtccttgtctgactggttagctgaaaataatgtccctggaatatgtgacatt
gatactagagaactgactaaaaggattcgtgagaaaggttgcatgaaagctaaggtaatc
gttaaggacgacgattcaagtaaagttcctttcatagatattggcagtgaaaatctagtg
gaaattgtatctgtaaaggaacctaaaatatacaatcctgacggagatgtaagcattgtc
gctgtcgattgtggtatcaaatataaccagatccgctgccttgtgactagaggagctcgt
gttaaagtagtgccgtggaattattaccttgacagttctgaatatgatggtttgttttta
agcaatggtcctggcgatccagtgagataccaggcaacgatatccaatgttcaacgaatt
ctgaatgaaacctcacctaaacctgtctttggaatttgccttggtcatcagttaatgtcc
ctagctgttggtggtaaaattataaaaatgcgatatggcaatcgtggtcataaccaacca
tgtattcaccacgaaactggtcgttgttttatcacaactcaaaatcatggatacgctgtt
gataaagtgcaatctttgaaagattggtcggtcctctttactaatgcgaatgatgatacc
aacgagggtattgtacacgatcgatttccttttttttctgttcaatttcaccctgagcac
agaggagggccgcaagatttagagcagttatttgatgaatttctatcgatagtacgtgac
cataaatcaggaaaagattatagtaaactatcgccaaaaattcgcctacataatcgcttc
ctaactaatcaggcatgtggcaaggctcaaacaaatgcaaaaaaggttcttttacttgga
tctgggggcttgtctatcggacaagctggcgaattcgattattcaggttctcaggctatt
aaggctctgaaagaagaaggtatatacacaatacttgtaaatccgaatattgccacggtt
cagacatcgaaaggattagctgacaaagtttacttcttaccaattactccttcatatgta
tctcagattattaagagtgaacgtcctgatgggatcctgctatcatttggagggcagaca
gcgttaaattgtggtgtcgctttaaaggagagcggtgtcttagatcaatataatattcaa
gttctcggaacatcgatacagtcaattatctgtactgaagatagactaaaatttgctaag
aaactggaagagattaatgaatctattgctcctagtaaagttgcctatactgtcgacgag
gcgataaatgcggctgaagcactcggctatcctgtgctagttcgtgcagcatttgccctt
ggcggtcttggttcaggatttgctgaaaataagcaagaaatgatttcagttgcaaaatca
gcttttgctcatacgaaacaattattaattgataaatcgttacgcggatggaaagaaatt
gaatacgaagttgttcgagatgcttatgataattgtattacggtttgtaatatggaaaat
gttgatcctttgggtatacacactggtgaatctattgttgttgctcctagtcaaacactg
accaatgaagaatataatcggttacgatctgtagccattaagactatcagacaccttgga
gttattggagaatgtaacattcaatatgctgttgatccagctagcgataagtattgtatt
gtcgaagttaacgcaagattatcccgtagttctgcattggcatcaaaagcaacgggatat
cctctcgcttatattgctgctaagctttcgcttggattcagcctagctgcactacgtaat
tcggtaacaaattctacaacagcctgttttgaaccaagccttgattacgtagttgttaag
atacctagatgggatttatctaaatttgcacgtgttgatacaaagattggtagctctatg
aaaagcgtaggagaagtaatggcaattggtagaaaatttgaggaagctctacagaaggca
ttaagaatggtagacgaccactgcttgggctttgaacctgaatctactgatgttaacgaa
gaggaattaatgtttccatcgaataagcggatctatgaaattgcatctgcgttgaggaat
aattatactattgaccgattacacaaattaaccaaaattgatccatggtttttacataga
atgaaagcaataagtgaatttatggtcaagatgtccaagtataagggaaagctacaagaa
attcagaaatctactctgtcacatgcgaagaaattaggattttgtgataaacagatagca
aaatatttagaaagcactgaactagctgtccgatataagagaattgatcttggaattcac
ccatttgttaaacaagttgacaccgtagctgcagagtacccagcatgcaccaattacctc
tatttaacttataatggttcatcgcatgatgttaaattccagaatttgaaacatgttctg
gttttgggatctggtgtctacagaattggaagtagtgtagagtttgattggtgcgcagtt
aactgtattaggcaacttcgtaagctgggtaaaaagacaataatggtaaattataatcct
gaaactgttagtacggactatgacgaatgtgataaattgtattttgacgaaatttcgttt
gagaccgttatggacatttacgaaatggaacaaccggaaggagtcatactatcgatgggt
ggtcagttgcctaacaatatcgcaatgccacttcataggcagcaggtcaaaatcttggga
acatccccagagcagattgacaatgctgaaaatcgttataaattttctcgattgcttgat
gtcatcaagatcaagcagccactatggaaaaatcttacgaatatggaaagcgccgagaaa
ttctgcgacgaagttggttatccgtgtttggttcgtccatcatatgtcttaagtggtgca
gcaatgaatgtagcaagctctcgcgaagagctagagacgtatttgcatagtgcggtcgca
gtatcaagagatcatcctgtagtaatatctaaatttataacggaagcaaaggaaattgat
gtcgatgctgtcgcactagaagggacaattgttgctttggctgtatctgaacatatcgaa
aatgctggcattcattcaggagatgctaccttagtactaccacctcaagacttaaacgac
gaaactttaatgaagatcgaaaacattacgaaagctattggatcagccttaaatgttact
ggcccatttaatttacagctgatcgcgaaagataatcaattgagggtgatagaatgtaat
ctacgggtatctagatcctttccttttgtttccaaaactgtcgggcataattttgtggct
attgctacaaaggtaatgatgggaatacctattgaagagtttgttggctatcaagtatgt
gatcgtatcggagtcaaggttcctcaattctcattttcgcgcttagctggatctgatgtg
atgctaggtgttgaaatggctagtactggagaggttgcatgttttggtgaagatcgatat
gaagcctaccttaaggcgatgattagtacaggatttaagattcctaggaagactgtacta
atctctatcggaagttataagtccaaattagaaatgcttcgtagcctccaaattttggaa
tcgttgggatataaattatatggcacccttggtactcaagatttttatgcgcaacataat
attactatggaagttgttgagtggcgttttgatgatttgggtagtgaagactctagcagt
ctcgggaagtacttagcgcaaaataaattcgatatggtcattaatctaccaatgagatct
ggtggcagccgaagagtgtcttcttttaataccctcggctatcgtacacgccgcttagcg
gtagactattctattcctttaattacggacataaaatgtgcaaagctgttaattgagtca
ctatatcgtattggtggagctccttctatcaaaaccaacattgactgtattacatcccat
cgttgtcttcgattacctggtcttatcgatgttcatgtccacgtaagagagcctggagct
acacataaagaagactttaaaactgctactgctgcagcacttgctggcggtattactgcc
atttgtgcgatgccaaatacaaatccacctgtaatcgatattgattcttttgagtatacg
aaaaagcttgctcagcaaagtgcaagatgtgattatgctctatacgttggtggaagtaca
accaatgctgaaatattaccggaagttggtgacgccgctgttggattaaaaatgtattta
aatgacacgtatacatctttgagattggactctgttgctgattggatgaagcatttcgaa
aattggccaacacatttgccgattgtagcacatgctgaagctcgaacaaccgctgcagta
ctacttttagcccaaatatataatcgtcctgttcatattgcccatgttgcacggaaggaa
gagattcttgttatcaaagcttgtaaagaacgtggtatgaacgtcacgtgtgaagtcgct
cctcatcatttgtttcttacagaagatgatgcagagcgcatagggctaaaacgatcgaag
gtcaagccccaactgtgctctaaggatgatcaacaggcattatgggataattttgatatt
attgactgtttcgccaccgatcacgctccccatacaatcgaagagaaagactcagaaaat
ggaccacctggctttcctggtttagaaacaatgttacctttgcttttaaatgctgtacac
caaggcaggttaacggttgaggatatcgtggaaagattatatacaaatccaatgaaaata
tttaatttacctgaacaaaaggatacctacatagaaattgatatagacgaatcttggact
attccacagttaatgcctcagacaaagtcaaagtggacaccttttgcgggtatgcaagcc
aaaggtgtcatccgtcgtgttgtacttcgtggagaagttgcatatattgatggaaaagtc
ttagcagccccaggttatggtaaagatcttaaggaagctcaacgacaaccaactcctggg
tttcaacatcgtgaccaccgtcctcagtcgcctgttcgatctgatcggataccgaaacga
atccatcgtttaactgatggtgcaggtaattactatatctatattatttcgacgataggg
ccaagtagcgcaccgtcaaaatttccgattaacttacctgcttcaagctttcccagtgat
actgaaatgccgttttctggttctgtttctatatcaaactcggatttctacggtcatagt
atagtttcggtatctatgtttacgcgtgaaaatctacataccttatttaaccttgcacat
gaaatgaaagtcgctacagagaaatatggaaagataaatgtattggcgaataaggtcatg
gctttgatgttttatgaagtcagtaccaggacatctagttcatttacagccgcgatgcag
agattgggaggaagtattgtatcaatttcgagcaaagattcttctgctaagaaaggggaa
tcagtggaagattcagttcatgtcatggaatcttactgtgatttagtcgtcttgagacac
cctgaacccggaattgtaaaaagggttgctgcaatagcaactaaacctatcattaatgct
ggtgatgggattggagaacacccaactcaagcactcctggatgtatttactataagagaa
gaaatcggtacagtcaacgacatcacgattacaatggttggcgatttaaaacatggaagg
acggttcattctttggcaagattattatctttataccgtgtaaacttgagatatgtttgc
ccaccgtcattaaaaatgcctgatgatgttatatcggaattaaatgggaaaggcattcct
cagaaatacttcaattccattgaggaagctcttccagaaacagatgtattgtatatgaca
cggatccaagcggagcgctttccaaatgttgaagaatatgaaaaggttttcggtagccat
gttttgacacctgaagttctcaaccatgctaaggagaaaatggcaatcttacatccactg
cctcgtgtgaatgaaataagcattgaagtagattcggatccacgtgcggcgtactttcga
caggtcgaatatggaatgtacgtaagaatggccctacttgcgcttatagttggaaagaac
tga

DBGET integrated database retrieval system