KEGG   Trichoplax adhaerens: TRIADDRAFT_29716Help
Entry
TRIADDRAFT_29716  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
tad  Trichoplax adhaerens
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Metabolic pathways
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:tad00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    TRIADDRAFT_29716
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TRIADDRAFT_29716
  Lipid metabolism
   00071 Fatty acid degradation
    TRIADDRAFT_29716
  Amino acid metabolism
   00350 Tyrosine metabolism
    TRIADDRAFT_29716
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    TRIADDRAFT_29716
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    TRIADDRAFT_29716
   00982 Drug metabolism - cytochrome P450
    TRIADDRAFT_29716
Enzymes [BR:tad01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     TRIADDRAFT_29716
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 338 aa AA seqDB search
MKAAQVVEAGAPLQLQEVPLPKATHDEVVIKVISVGVCHSDLHLWDGGYDLGGHYPVTPG
HEIVGSVHQMGDEVVDFAVGDNVLVFPWIGCGQCPICQAGDDNVCDKPRSIGIFCNGGYA
EYVIIPSYKYLAKISGVDFHAATSLACSGLTAYNAIKKANVRSPEYLVIIGTGGLGLMGI
QLAKATTQAKIICVDIDDQKLNIAKNLGADFIVNSSDGNAVQKIYSICPKGVDSVVDFVN
ASPTAKIGLSILKKRGNLVLVGLFGGSIEISLVTIPLKTLIIQGAYTGTYREMVELLQLA
KEGIINPIISKQYSLQEANTALNDLKQRKIVGRAVIIP
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgcacaagttgtagaggcaggtgcccctctccaacttcaagaagtcccactg
cctaaagccactcatgatgaggttgtgatcaaagtgatttctgtaggcgtttgccatagt
gatctgcacttatgggatggtggttacgatcttggaggccattatccagtaacccctggc
catgaaattgttggtagtgtccatcagatgggtgatgaagtagttgattttgctgttggg
gataatgttcttgtattcccttggattggttgtggtcaatgcccgatttgtcaagcgggc
gatgacaatgtttgcgataaaccgagatcgattggcattttttgcaatggtggttatgct
gaatatgttattattccaagttataaatatcttgctaagatttctggtgttgatttccat
gctgccacatcgcttgcttgctcaggtttaactgcctataatgcaatcaagaaagcgaat
gtaagatctccagaatatttggtcatcataggtactggtgggctgggtctgatgggcatt
caattggcgaaagcaacaactcaagcgaaaatcatttgcgttgatatcgatgatcaaaaa
ttaaatatagcaaagaatttaggcgctgattttattgttaactctagcgatggcaatgca
gtgcagaaaatatactccatctgtcctaaaggcgtcgatagtgttgtcgattttgttaac
gcctctccgacggcaaagataggattatccatacttaagaagcgtgggaatttagtgctt
gtaggattatttggtggttctatcgaaatctctttagtgacaataccactaaagacctta
attattcaaggcgcttacacaggtacttatagggaaatggtagagttgctacaattggcc
aaagaggggatcattaatccaattatttcaaagcagtattctttacaagaggctaatacc
gcattaaatgacttaaaacagaggaagattgtagggcgagcagtaatcatcccataa

DBGET integrated database retrieval system