KEGG   Trichoplax adhaerens: TRIADDRAFT_29866Help
Entry
TRIADDRAFT_29866  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
tad  Trichoplax adhaerens
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tad00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    TRIADDRAFT_29866
Enzymes [BR:tad01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.24  glutamate---tRNAGln ligase
     TRIADDRAFT_29866
Amino acid related enzymes [BR:tad01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   TRIADDRAFT_29866
Transfer RNA biogenesis [BR:tad03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    TRIADDRAFT_29866
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 383 aa AA seqDB search
MIYVANVSRIAWRIVLLDQRFSSNCASNKSNVRVRFAPSPTGMLHLGGLRTMLYNYLFAR
QQRGQVILRIEDTDQTRLVPGADKKLEEIIWWSGLHYDEGPSVAGEYGPYYQSQRIPLYQ
KYANRLIENDYAYPCFCTQRELDLVKMQNIKSGLNPRYNGKCRSISREIASARIQNGESH
VIRLKVPDGQTNFYDQVYGEMSIDNKSIEDQVLIKSDGFPTYHMANVVDDHLMDITHVLR
GEEWLSSTAKHALIYKGLTWICPQFVHLPLLHNITGGKLSKRHGDVFVESFKTAGYMPEA
VVNFVAFLGWSPDPTGRRQLFTIDEMINEFSLENLRRTAAKVDYQKLSWFQRQYHTTRCK
NESKLEALVSELKELVIKTTCNG
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgatttacgttgcaaacgtcagcagaattgcatggcggattgtgctgctagatcaacga
ttcagcagcaactgtgcaagcaacaagagcaatgttagagttcgctttgcaccaagtccg
actggtatgctgcatttaggtggcttacggactatgttgtacaattatttatttgcacgg
caacaacgaggtcaagtaatcttgagaattgaagatactgatcaaacacgtctagttcct
ggagctgataaaaagctagaagaaatcatttggtggtctggcctacactatgatgagggg
ccttccgttgcaggtgaatatgggccgtactatcagtctcaaaggattcctctctatcaa
aaatatgccaatcggttgatagaaaatgattacgcgtatccttgcttttgtacgcaacga
gaattggaccttgtcaagatgcagaatatcaagagtggcttaaatccaagatacaacggt
aaatgccgtagtataagtcgtgaaattgcctcggctagaattcagaatggtgagagccat
gtcattcgattaaaggttcccgatggccagacaaacttctatgaccaggtgtatggtgaa
atgagcattgataacaaatccattgaagatcaggttttaattaaatcggatggttttcct
acttatcatatggcaaatgtcgtggacgatcatttaatggatattacgcatgttttacga
ggagaggaatggctttcctcaacagcaaaacatgctttaatatataaagggctgacatgg
atttgtcctcaatttgttcatttgcctctattgcacaatataactggaggaaagttatct
aaacggcatggcgatgtctttgtggaaagtttcaagacagcgggctatatgcctgaggcc
gtggtgaattttgttgcattcttaggctggtctcctgatcctactggaaggagacaactg
tttacgattgatgagatgatcaatgagtttagcttggaaaatctgagacgaacggcggca
aaagttgattatcaaaagctatcatggtttcagaggcaataccacactacacgatgcaag
aatgaatcaaaattagaagcattagtaagcgagctaaaagaattggtaataaaaacgaca
tgtaatgggtga

DBGET integrated database retrieval system