KEGG   Trichoplax adhaerens: TRIADDRAFT_29866Help
Entry
TRIADDRAFT_29866  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
tad  Trichoplax adhaerens
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:tad00970]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 383 aa AA seqDB search
MIYVANVSRIAWRIVLLDQRFSSNCASNKSNVRVRFAPSPTGMLHLGGLRTMLYNYLFAR
QQRGQVILRIEDTDQTRLVPGADKKLEEIIWWSGLHYDEGPSVAGEYGPYYQSQRIPLYQ
KYANRLIENDYAYPCFCTQRELDLVKMQNIKSGLNPRYNGKCRSISREIASARIQNGESH
VIRLKVPDGQTNFYDQVYGEMSIDNKSIEDQVLIKSDGFPTYHMANVVDDHLMDITHVLR
GEEWLSSTAKHALIYKGLTWICPQFVHLPLLHNITGGKLSKRHGDVFVESFKTAGYMPEA
VVNFVAFLGWSPDPTGRRQLFTIDEMINEFSLENLRRTAAKVDYQKLSWFQRQYHTTRCK
NESKLEALVSELKELVIKTTCNG
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgatttacgttgcaaacgtcagcagaattgcatggcggattgtgctgctagatcaacga
ttcagcagcaactgtgcaagcaacaagagcaatgttagagttcgctttgcaccaagtccg
actggtatgctgcatttaggtggcttacggactatgttgtacaattatttatttgcacgg
caacaacgaggtcaagtaatcttgagaattgaagatactgatcaaacacgtctagttcct
ggagctgataaaaagctagaagaaatcatttggtggtctggcctacactatgatgagggg
ccttccgttgcaggtgaatatgggccgtactatcagtctcaaaggattcctctctatcaa
aaatatgccaatcggttgatagaaaatgattacgcgtatccttgcttttgtacgcaacga
gaattggaccttgtcaagatgcagaatatcaagagtggcttaaatccaagatacaacggt
aaatgccgtagtataagtcgtgaaattgcctcggctagaattcagaatggtgagagccat
gtcattcgattaaaggttcccgatggccagacaaacttctatgaccaggtgtatggtgaa
atgagcattgataacaaatccattgaagatcaggttttaattaaatcggatggttttcct
acttatcatatggcaaatgtcgtggacgatcatttaatggatattacgcatgttttacga
ggagaggaatggctttcctcaacagcaaaacatgctttaatatataaagggctgacatgg
atttgtcctcaatttgttcatttgcctctattgcacaatataactggaggaaagttatct
aaacggcatggcgatgtctttgtggaaagtttcaagacagcgggctatatgcctgaggcc
gtggtgaattttgttgcattcttaggctggtctcctgatcctactggaaggagacaactg
tttacgattgatgagatgatcaatgagtttagcttggaaaatctgagacgaacggcggca
aaagttgattatcaaaagctatcatggtttcagaggcaataccacactacacgatgcaag
aatgaatcaaaattagaagcattagtaagcgagctaaaagaattggtaataaaaacgaca
tgtaatgggtga

DBGET integrated database retrieval system