KEGG   Trichoplax adhaerens: TRIADDRAFT_30101Help
Entry
TRIADDRAFT_30101  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
tad  Trichoplax adhaerens
Brite
Enzymes [BR:tad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     TRIADDRAFT_30101
Protein kinases [BR:tad01001]
 Serine/threonine protein kinases: AGC group
  PKG family
   TRIADDRAFT_30101
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 680 aa AA seqDB search
MQDLNSTLRSLREKIERKDTRIRILEKRLVEYEEENRQLRIKLNKFQDVMIPSITQKVHR
LGISAEPQRVSRISQIKLDGLKTYEKNQRSKELIKAAILSNDFLRNLDEAQVGEIVSCMY
PYDYKQDHYIIKEGESGNHLYVIEDGEVEVTKEGKILSYMKSRTVFGELAILYNCKRTAT
VKGIISYFNTLFGLAAITDTKLWLLDRASFQSIMMRIGIDKHHQHMTFLKGVPIFESLPE
DIISKLANVLEEAKFRKDEYVIREGAHGDTFYIISYGRVKVTKTTKEGEQFIRILQEKDS
FGEKALLEEEKRSANVIAMDEEVTCLVVDRESFVSLIGHIKSVGHREELFKAKYPSHSES
SDNLKLEDMELLKTLGVGGFGRVELVKVKQDSSVSYALKILKKRHIVETRQEEHIMSEKK
ILLEANCPFIVKLYKTFKDTRYLYMLLEACLGGELWTILRDRGHFDDKVTRFYTGCVVEA
FSYLHNNGIIYRDLKPENLLVDSRGYAKLVDFGFAKRIGFGYKTWTFCGTPEYVAPEIIL
NRGHDFSADYWSLGILIYELLTGSPPFTGSDPMQIYNLILKGMDAIDFPRNRISKQAQNL
IKKLCRENPNDRLGYQKNGLKDIMKHKWFDGFNWIGLRSRTLDPPYKPKIRSPFDGGNFD
DYPPDEDDVLEDDSGWDQSF
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atgcaagacctcaattcaactctgcgtagtttgcgcgaaaaaatagaaagaaaagacacg
cgaataaggatattagaaaaacgtttagtagaatatgaagaggaaaataggcagctcagg
ataaagctcaacaaattccaagatgtcatgatacctagcataacacagaaagtccaccgt
ttaggaatatctgcagaaccacagagggttagcaggatttcgcaaataaagttagatggc
ttaaaaacttatgaaaagaatcaaagatcgaaagagttaattaaagctgcaattctaagt
aatgacttcctaagaaatctcgatgaagcgcaagttggagaaattgtaagttgtatgtat
ccttatgattataagcaggaccattacataattaaggaaggagaatctggaaatcatttg
tatgttatcgaagatggtgaggttgaagttaccaaggaaggtaaaatcctgagctacatg
aaatctaggacagtgtttggagagcttgccattctctataactgcaagcgaacagctact
gtaaaaggcataatatcttattttaatactttgtttggacttgcagcaattactgatacg
aaattgtggctattggatcgggcaagtttccaaagtattatgatgagaattggtatcgat
aagcatcatcaacatatgactttccttaaaggggtgccaatttttgaaagtttaccggaa
gatatcatctcgaaattagctaatgttttggaagaggccaagtttagaaaagatgaatac
gtcatccgtgaaggtgctcatggtgacacgttttatattattagctacggccgggttaaa
gttacaaaaactacaaaggaaggtgagcaattcataagaatcctccaagaaaaggactct
tttggtgaaaaagccctccttgaagaagaaaagcgttcagcaaatgtgattgcgatggat
gaggaagtaacctgtctagttgttgatagagaatctttcgttagcttaataggacatatc
aaatccgttggacaccgagaagaattatttaaagcgaaatatcccagtcattcagaatct
tcggataaccttaagttagaagatatggagttactaaaaacccttggtgtaggaggattt
ggtcgtgtcgaactggttaaggtgaagcaagacagtagtgtctcttatgccttgaaaata
ttgaaaaagcgacatattgtagaaactcgccaagaagagcatataatgtctgagaaaaaa
atattattggaagccaattgtccttttattgtcaaactctacaagactttcaaagatacg
agatatttgtatatgttacttgaagcctgcctaggaggtgaattgtggactattttaaga
gacaggggtcattttgacgataaagttactcgtttttatactggttgcgttgtggaagct
tttagttatttacataataacggaatcatttatcgtgacttaaagcctgagaacctgtta
gttgactcacgaggatatgctaaactggttgattttggattcgctaagaggattggtttc
gggtataaaacttggactttttgtggaacaccagaatacgtagcacccgaaataattctc
aatcgtggacatgatttttccgcagactattggtcacttgggatcttaatttacgagtta
cttactggaagtcctccgtttactggatccgatcctatgcaaatatataaccttatccta
aaagggatggacgccatagattttcccagaaatagaatatcaaaacaagctcaaaacctg
attaaaaagttatgccgtgagaatcccaatgatcgtcttgggtatcaaaagaatggttta
aaggacattatgaagcacaagtggttcgatggatttaactggataggcctacgcagtaga
acacttgaccccccttacaagccgaagattcgtagtccgttcgatggaggtaatttcgac
gattatccgccagatgaagatgacgttctggaagatgactctggatgggatcagagcttc
tag

DBGET integrated database retrieval system