KEGG   Trichoplax adhaerens: TRIADDRAFT_30150Help
Entry
TRIADDRAFT_30150  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K04440  
c-Jun N-terminal kinase [EC:2.7.11.24]
Organism
tad  Trichoplax adhaerens
Pathway
FoxO signaling pathway
Protein processing in endoplasmic reticulum
Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:tad00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    TRIADDRAFT_30150
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    TRIADDRAFT_30150
   04068 FoxO signaling pathway
    TRIADDRAFT_30150
Enzymes [BR:tad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     TRIADDRAFT_30150
Protein kinases [BR:tad01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   TRIADDRAFT_30150
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 363 aa AA seqDB search
MFRTEIVSDTTFTVLKRYEDLKVIGAGSQGIVCAADDTKTGNRVAIKKLSRPFQNVTHAK
RTFRELVLMLIMKHKNTIRLLNLFTPNRSLEEFSELYLVMELMDANLCQVINLELDHDRM
SYLIYQLLCGLKYLHSAGILHRDLKPSNIVVKSDCTLKILDFGLARITGNEFMMTPYVVT
RYYRAPEVVLGLGYQENVDVWSVGCIMGEMIRGTVLFPGDDHLDQWNKIIQQLGTPPDDF
LDKLGHSTRNYILSQHGNRAGLPFKVLFPDSLFPNGSEDDDDDNYTNQARDLLSKMLIMD
ASKRTSVVDALQHPYVRQWYDASECEVPPPTRYDHTIDDAKYPVEKWKGKDLHQEKLFLD
FCP
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgtttcgtacagaaatcgttagcgacactacttttactgtattaaagcgttatgaagat
ctgaaggtcattggagccggttcacaaggaatcgtttgtgctgctgatgacacaaaaacc
ggtaatcgcgtagcaatcaagaaattgagccggccattccaaaatgttacgcatgccaaa
agaacatttcgagaattggtattaatgttgataatgaagcacaaaaatactattcgtttg
ctgaacttatttacaccaaatagatcgcttgaagaattttcggaattatatcttgtaatg
gagttgatggatgccaacttatgccaagttataaatttggaattggatcatgatcgcatg
tcatatttaatttatcaattattatgtggtctgaagtatttacactccgctggcattcta
catcgggatttgaaacccagtaacattgtcgtcaaatccgattgtactttaaagatcctc
gattttggtttggcaagaattactggtaatgaatttatgatgacaccgtacgtggtaaca
cgatactatagggcccctgaagttgttttaggtcttggttatcaagagaatgttgatgtt
tggtcggtcggctgtataatgggagaaatgatccgtggaacggtactttttccaggagat
gatcatcttgaccaatggaataaaataattcagcaacttggtacaccgcctgatgacttc
ctagataaactaggccattcgacgcgcaattacatcctatctcaacatgggaaccgtgct
ggtttaccgtttaaagttcttttccctgatagtttatttccaaatgggtcagaagatgat
gatgatgataattacaccaatcaggctcgggatttactgtcaaagatgttaataatggat
gcatcaaaaaggacttccgtagtagatgctctccaacatccttacgttcgtcagtggtat
gatgcatccgaatgtgaagtgccacctcctacacgctatgatcatacgatagatgatgcg
aaatatccagttgaaaaatggaaaggtaaagatttgcatcaagagaaactatttttagat
ttctgtccttag

DBGET integrated database retrieval system