KEGG   Trichoplax adhaerens: TRIADDRAFT_30166Help
Entry
TRIADDRAFT_30166  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
tad  Trichoplax adhaerens
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 587 aa AA seqDB search
RQLIRRVILENDFMKHLQMPQVQEIVKCMYPCTFNESDIIIREGEYGNRLYVTAEGNFEI
TKDGTLLTKVGAGVAFGELAILYNCRRTATITATTKCKVWAIDREVFQMIMLKTGIAQHE
EHMQFLESVPLLKHLPAGKLAKIAGVLDVNYYKQEEYIVRENETGDTFYIIKKGEVIVTR
RMIEKNSDVFVRTLVRGDYFGERALLSEERRTANIIVQSSEVECFVLDREYFTQLIGNLD
ELKEKDYHDEVYRGTKLAIRNPSSTTNEYSELELNDFEQIATLGMGGFGRVELVTLVKDK
SRSFALKCMKKRHIVETKQQEHVFSEKKLLTELTSPFVVKLYRTFKDKKFVYMLMEVCLG
GELWTILRDRGNFDENSTRFFTACVVEAFDYLHVRGIVYRDLKPENLLLDSIGYVKLVDF
GFAKKVGLGSKTWTFCGTPEYVSPEVILNRGHNFCADYWGLGILIFELLTGSPPFTSDDP
MKTYNLILRGIDRVDFPRKIGKNAQNLIRKLCKENPAERIGYQKNGIKDIQKHKWFQGFD
WNGLRKRELKSPMQPTINGPLDHSNFDTFDQSNELPTDETSGWDDNF
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
aggcagctaataagaagagtcattctagaaaacgacttcatgaaacatttacaaatgcca
caagttcaagaaatcgtaaaatgcatgtatccatgtacttttaatgaaagcgatataatt
atacgcgaaggagagtacgggaatagactgtacgttacggccgagggaaatttcgagata
acaaaagatggaaccctcctgactaaagttggagctggggtagcttttggggaattagca
atattatataattgtaggagaacagcgactattactgctacaacaaagtgtaaagtatgg
gctatagaccgcgaagtatttcaaatgattatgttaaaaaccggaatagcgcaacacgag
gaacatatgcaatttttggaaagcgttcctctactgaaacacctacctgccggaaagctc
gctaaaattgctggtgtactagatgttaattactataagcaagaggagtacattgtccgt
gaaaacgaaacaggagatacattttacataattaagaaaggagaggtaattgtaacgaga
cgaatgattgaaaagaatagtgacgtcttcgttcgtactcttgttcgaggggactatttt
ggcgaaagagctttacttagtgaggaaagaaggacagcaaatattatcgtccaaagttca
gaagttgaatgttttgtattagatcgcgagtattttacacagttgataggtaatctcgat
gaattgaaggagaaagattatcatgatgaagtctacagaggaactaagctggctattaga
aatccatcatccacaaccaatgaatatagcgaactagagttaaatgattttgaacaaatt
gcaactctaggaatgggaggctttggcagagtggaattggtgacactagtgaaagataaa
tcgagatcatttgcgttaaaatgtatgaagaaaagacatattgtggaaacaaaacagcag
gagcacgttttctctgagaagaagttattaacggaactaacttctccgtttgtcgtgaaa
ttatatagaaccttcaaggataaaaaatttgtatacatgttgatggaagtctgtttaggt
ggtgaattgtggaccatcttaagagacagaggaaattttgatgagaatagcacgagattt
tttaccgcttgcgtggtagaggcatttgattatctccacgtcagaggaatagtttatagg
gatcttaagcctgaaaatttgctcttagactcaatcggctatgtaaaattggtcgatttt
ggttttgctaaaaaagtcggactcggaagtaaaacttggacattttgtgggacacccgaa
tatgtatctccagaagtaattttaaatagaggccataacttttgtgctgattactggggc
ttagggattttaattttcgaattattaactggaagcccaccctttacatccgatgacccg
atgaaaacatataatttaatactgcgaggcatagatcgcgtcgattttccgcgaaagatt
ggcaaaaatgcgcaaaacttaatcagaaaattgtgcaaagaaaacccggcagaaagaata
ggttatcaaaagaacggtattaaagacattcagaagcacaagtggtttcagggatttgat
tggaacggtctaagaaaacgggaattaaagtcgcccatgcaaccaacgattaacggtcca
ttagaccattcaaattttgatacctttgatcaaagcaatgagctaccgacagacgagact
agtggatgggacgataacttttaa

DBGET integrated database retrieval system