KEGG   Trichoplax adhaerens: TRIADDRAFT_30170Help
Entry
TRIADDRAFT_30170  CDS       T01069                                 

Definition
protein phosphatase 1 catalytic subunit gamma isoform
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
tad  Trichoplax adhaerens
Pathway
mRNA surveillance pathway
Class
Genetic Information Processing; Translation; mRNA surveillance pathway [PATH:tad03015]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 328 aa AA seqDB search
MSETDKLNVESIISRLLEVRGSRPGKNVQLSESEIRGLCLKSREIFLSQPILLELEAPLK
ICGDIHGQYYDLLRLFEYGGFPPDSNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFL
LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPVAAILDEKIFCCHGGLSPDL
MSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKEIMGWGENDRGVSYTFGGEVVGKFLSKHD
LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAD
KKKFSYSNVNPGRPNTPPKNQKPKGVKK
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaacagacaagcttaatgttgaaagtatcatctctagattactagaagttcgt
ggttctaggcctggtaaaaatgtccaattgtcggaaagtgaaattcgtggtttatgttta
aaatcgcgtgaaatatttttgagtcaacctatcctattagaactagaggctcctttaaaa
atctgtggtgatattcacgggcagtactatgatttattaaggcttttcgaatatggcggt
tttccacctgattctaattacttattcctgggtgattatgttgatcgtggcaagcaatca
ctggaaacaatttgcttactcttagcatataaaattaagtatcccgagaatttctttttg
ttacgagggaatcatgaatgcgctagtattaatagaatatatggattttacgatgaatgt
aaaaggaggtacaatatcaaactgtggaagacgtttaccgattgctttaattgtttacca
gtagcagctatattagacgaaaagatcttttgttgtcatggcggtctatctccggatctt
atgtctatggaacaaattagaagaatcatgagaccaacagacgttcctgatcaaggatta
ctatgcgatttattatggtcggatcctgataaagagataatgggctggggtgagaatgat
cgtggagtctcatacacgtttggtggtgaggtcgttggtaaattcttaagcaaacatgac
ttggatttgatttgtcgcgcacatcaggttgtggaagatggctatgaattttttgctaag
cgtcaattggttacactattttctgcacctaattattgtggtgaattcgataatgctggt
gctatgatgagtgtcgatgagacattaatgtgctcgttccagattcttaaaccggcggat
aagaagaaattttcttatagcaatgtcaatcctggaaggcctaatacacctccaaaaaat
cagaaaccaaaaggcgtaaaaaaataa

DBGET integrated database retrieval system