KEGG   Trichoplax adhaerens: TRIADDRAFT_30184Help
Entry
TRIADDRAFT_30184  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
tad  Trichoplax adhaerens
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:tad00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    TRIADDRAFT_30184
Enzymes [BR:tad01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose-protein mannosyltransferase
     TRIADDRAFT_30184
Glycosyltransferases [BR:tad01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   TRIADDRAFT_30184
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 641 aa AA seqDB search
MEKTDTRGTAKEKTEPGYVRKYLPVICFLLVCLLTCSTRLYKLDEPQHVCWDEAHFGKHG
SWYINRTFFFDVHPPLGKMSIGLIGYLTGYNGTFAFDKPGDKFNGHLVMGMRYFCAILGC
FFVAFVYLITWELSQSVEASCLASLFAIFDHGTITLSRYILLDPILLFYIMSSTYFGIKF
LNTKNRPYSLSWWLWLSLTGVSLGCAISVKFVGLFVILFTGYSTVMDLWRLFGDLNLSMV
DLIKHFLARAVCLILIPLLVYSLLFVIHLKVLHKSGKGDGFYSSSFQATLKGNDLYDVKL
PTYVAYGSVVTIRNYRSGGALLHSHPHLYPPTVAKMQQQQVTTYSHKDENNLFMIKKHNA
SYSDQQSLEYVKNGDIIRLEHVQTKRNLHSHLERAPVTKRHYQVTCYGNNGTGDDNDYWV
IHATNAEIGSKISIVKSILRFVHYNVKCALHSHEKQLPKWGWEQMEVTCNPKIKHKNNLW
NIEGHQNPRLSVDDSDVHKASTYQKFLESHFVMLQGNSNLKPKEGEYTSQPWHWPITYKG
QHFSGGDFRIYLLGNPVLWWTNLIVLISFPFGYLYHAIRCQRGCQDQNELRTKLFSSCWW
LYLGWATHYIPFYLMGRVLYFHHYFPSYLYSCMITGTCKPK
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atggagaaaacagacactcgtggaactgccaaggaaaagactgaacctggttatgtccgt
aaatatctacctgttatctgctttcttctggtttgtttattaacctgttcgacaagactt
tataagttagatgaaccgcaacatgtctgttgggacgaagcccattttggtaagcacggt
agttggtatattaatcgaacgttctttttcgacgttcatccacctctcggcaagatgtcg
ataggcctaattggttacttaacaggctataacggaaccttcgcctttgataagcctgga
gacaagtttaatggacaccttgtcatgggtatgagatatttctgtgcaattttaggatgt
ttctttgttgctttcgtttaccttattacctgggaattaagtcaatcagtcgaagcttca
tgccttgcatctctatttgctatattcgatcatggtactattacactatcacgttatatc
ttactggatccgattttattattctatatcatgtcgtcaacctatttcggtatcaaattt
ttaaacactaaaaatcgtccttattcattgtcatggtggttatggctatctttaaccggc
gtttcgttaggatgtgcaattagcgtaaaatttgttggcctatttgttatcctgtttacc
ggttattcaacagtaatggatttatggagattattcggagatttaaatctgtcaatggtt
gacctgattaaacactttttggccagagcagtgtgcttaatcctgattcccttattggta
tattccttgttatttgtaattcatttaaaagtacttcacaaaagtggcaaaggtgatgga
ttttacagctcctcatttcaagccactttgaaaggaaacgacctttacgacgtcaaactg
cccacatatgttgcgtatggctcagtagttacaataagaaattaccgaagtggaggagct
ttattgcattcacacccacacttatatccacccacagttgccaaaatgcagcaacaacag
gttactacatattctcacaaagacgaaaataacctttttatgattaagaaacataacgcc
agttatagcgatcaacaatcgttagagtacgttaaaaatggcgacattatcagattagaa
catgttcaaactaaacgtaacctgcacagtcatctagagagagctccagttactaaaaga
cactatcaagtaacttgctatggaaataatggaacaggagatgataatgactactgggtg
atacacgcgactaatgccgaaattgggagtaaaatttctatcgtgaaatctattcttcgc
tttgtacattacaatgtcaagtgtgctttgcattcgcacgaaaaacaactaccgaaatgg
ggttgggaacaaatggaggttacgtgtaacccaaaaattaagcataaaaacaacctttgg
aatattgaaggccaccagaatcctcgattatcggttgatgactcagatgtacacaaggct
tccacttatcaaaagtttttggagtctcattttgttatgctacagggaaattctaatctc
aaacctaaagaaggagaatatacctcacaaccttggcattggccaatcacatataagggt
cagcacttttccggaggtgattttagaatatacttacttggtaacccagtactttggtgg
acaaacctaatagtgctgataagctttccatttggctacttgtatcatgcaataaggtgc
caacgaggttgtcaagatcagaatgaactgcgaacgaaattattttcttcttgctggtgg
ttatatcttggatgggcgacccattatattcctttttatttaatgggaagagttttatac
tttcaccattacttcccttcttatttgtacagttgtatgataaccggtacgtgtaagccg
aaatga

DBGET integrated database retrieval system