KEGG   Trichoplax adhaerens: TRIADDRAFT_30509Help
Entry
TRIADDRAFT_30509  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K13338  
peroxin-1
Organism
tad  Trichoplax adhaerens
Pathway
Peroxisome
Brite
KEGG Orthology (KO) [BR:tad00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    TRIADDRAFT_30509
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 299 aa AA seqDB search
DIEKALEGYTPAALRGASLHSPGDLSWQDIGGLNDIKAVLVETLLWPSRYPKLFASCPLR
LRSGILLYGPPGCGKTLLAGIVAKECGLNFISIKGPEILNKYIGASEQAVRDLFVRAQSA
KPSILFFDEFDSIAPRRGHDSTGVTDRVVNQLLTQLDGVEGLEGVYVLAATSRPDLIDPA
LLRPGRFDKCLRCDLPTKQERVEILKALSQKLTLSKDVDLDEIAESSEHFSGADLKGLLY
NAQITSIHESQQYYTKVSNTVQDYQPNKFTNKEILLIHGFNETPRSPNDTEIKEINAAV
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
gacattgagaaggctctagaaggatatacacctgcagccttacgtggtgcaagcctacat
tctccgggggatttatcctggcaagatataggaggactgaatgatatcaaggctgtctta
gtagaaactctactttggccatcaaggtatccaaaattgtttgccagttgtcctctccgt
cttcgttcgggaattctactatatggaccccctggttgtggtaaaacacttcttgctggg
attgttgcaaaggaatgcggattaaatttcataagtattaagggtccggaaatacttaat
aaatacattggtgctagtgagcaagctgttcgagatttattcgtgagagctcaatcagcc
aagccatccattttattttttgatgaatttgactcgattgcacccaggcgaggacatgat
agtactggtgttacagatcgagttgtcaaccaactcctcactcaattagatggagtagaa
ggcttggaaggtgtatatgtacttgctgcaaccagtcgacctgacttaatcgatccagca
cttttgcgccctggcagatttgataagtgtttaagatgtgatttgccaacaaagcaagaa
cgagttgaaatcttgaaagcgctttcacaaaaattaaccttatcaaaagatgttgaccta
gatgaaattgctgaaagttctgaacattttagtggggctgatctgaagggactcttatat
aatgctcagataacatctatacatgaaagccaacagtattatacaaaggtatcaaataca
gtccaggattatcaacccaataaatttacaaataaagaaatactactcatacacggtttc
aatgagactccacgatctccaaatgataccgaaattaaagaaatcaatgcagcggtatga

DBGET integrated database retrieval system