KEGG   Trichoplax adhaerens: TRIADDRAFT_30577Help
Entry
TRIADDRAFT_30577  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K11481  
aurora kinase A [EC:2.7.11.1]
Organism
tad  Trichoplax adhaerens
Brite
Enzymes [BR:tad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     TRIADDRAFT_30577
Protein kinases [BR:tad01001]
 Serine/threonine protein kinases: Other group
  Aur family [OT]
   TRIADDRAFT_30577
Protein phosphatases and associated proteins [BR:tad01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     TRIADDRAFT_30577
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 270 aa AA seqDB search
RKRWTLDDFDIGRPLGKGKFGSVYLAREKQSKYIVALKVLFKSQLQKANVEHQLRREIEI
QSHLRHPNILRLYGYFYDTSRVYLILEFAPGGELYKELQRQKVFDEPRAAKFIAQLSDAL
RYCHTKKVIHRDIKPENLLLGIKGDLKIADFGWSVHAPSSRRTTLCGTLDYLPPEMIIGD
EHDDKVDLWSLGILCYEFLVGCPPFETKTHEDTYKRIIKVDLKFPENKLSPEAMDLIRKL
LCRKPSERLSLDGVMSHPWIVKHVQNDAKN
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
agaaaaagatggacgttggacgattttgatattggcagaccattaggcaaagggaaattt
ggtagcgtgtacttagcaagagaaaaacagagtaaatacattgttgcgttaaaggttcta
tttaaatctcaactacaaaaggcaaatgttgagcaccagctaagacgcgagattgaaatt
caatctcatttgcgccatcctaatattctacgattgtatgggtatttttacgatacgagc
cgtgtgtaccttatacttgagtttgcaccaggtggagaactgtacaaagaattgcaacgg
cagaaagtatttgatgaaccaagagctgctaaatttattgcacaactctccgatgcattg
aggtactgtcacacaaaaaaggtcattcacagagatataaagcctgaaaacttattactc
ggtataaagggtgatcttaagattgctgatttcggttggtctgttcatgctccatcatca
aggcgaactacactatgtggaacgctggattacctacctcctgaaatgatcatcggtgat
gaacacgacgataaggttgatttatggagcttgggcatattatgctatgaatttcttgtt
ggttgcccaccattcgagactaaaactcatgaagatacttataaaagaattatcaaggtt
gatttaaagtttccagagaacaaactgagtcctgaggctatggatttaatcagaaagctt
ctatgtcgtaaaccctctgaaagattatcacttgatggcgtaatgtcacacccctggatc
gtaaaacatgttcaaaatgatgcaaaaaattaa

DBGET integrated database retrieval system