KEGG   Trichoplax adhaerens: TRIADDRAFT_30763Help
Entry
TRIADDRAFT_30763  CDS       T01069                                 

Definition
(RefSeq) hypothetical protein
  KO
K11674  
microspherule protein 1
Organism
tad  Trichoplax adhaerens
Brite
Chromosome [BR:tad03036]
 Eukaryotic Type
  Histone modification proteins
   HAT complexes
    NSL complex
     TRIADDRAFT_30763
  Centrosome formation and ciliogenesis proteins
   Nde1-Su48 complex
    TRIADDRAFT_30763
  Chromatin remodeling factors
   INO80 complex
    TRIADDRAFT_30763
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 399 aa AA seqDB search
RRSSSRSIKRKKFDDELVESSLKKTAKKIASANEIAAIPQVVIKDKKVLIVSINNNIHDP
IAPCRSHTMKNLGRWKPADDLALISAVQQTNDLAAVHLAVKFSCRFTLRDIEERWYSLLY
DPVISKLAISAIKPLHPDTIAAAQNNALWSKEEQQLLGGITSVNSPSLDVFKQMLMDNAD
TFHTSRTPKTLYNHWLLMRQYRLLPDQLVELSGKRETISFSDVERELDDEELTENRDEIL
DNEIAIAHRKSKLQIKKLETELPKWQEILDKIYDDDTPTFDFDSDTLAVLRGRLVRYFIR
KKEVTFGRAATDGDIDIDLSIEGPAWKVSRLHGYIKLKPDGTFHVKNEGRRPVYIDGKPV
TTGSRSTLPNNCTFEVCGLKFIFLISKTTVAKACNDPGQ
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
aggaggagttcttctcgatcgattaaacgtaaaaagtttgatgatgaattggttgaaagt
agcctaaaaaagactgctaagaaaatcgcctcagccaatgaaatagctgcaatacctcaa
gttgtgatcaaagataaaaaggtactgatcgtctctattaataataatattcacgatcct
attgcaccatgcaggtcccatacaatgaaaaacttaggcagatggaaaccagccgatgat
ttggctctgattagtgctgtacagcagaccaatgatttagcagcggtacatttagctgtc
aaattttcttgtcgatttacattaagagacatcgaggagcgatggtattcgctattatat
gatccagtcatttcaaagttggctatttccgctattaaacctttacatccagatactatt
gctgctgctcaaaataatgccttatggagcaaagaagaacaacaactactgggtggcata
acatcggttaattcaccatcattagatgtctttaagcaaatgttaatggacaatgcagat
acatttcatactagccgaacacccaaaactttatataatcattggttgttgatgaggcag
tatcgccttttgcctgatcagttagttgaactctctggtaaacgcgaaacaatatcattt
tctgatgtggaaagggaacttgatgatgaggagctgactgaaaatcgtgatgaaatttta
gataacgaaatagccatagcccatcgaaaaagcaaattacaaattaaaaaattagaaacg
gaattgccaaaatggcaagaaatactagacaagatctatgacgatgatacgccaacattc
gatttcgatagcgatacactagctgttttacgaggacgtttggttcgctattttattcga
aagaaagaggtgacatttggacgtgctgctaccgatggcgatattgacatagatttatcc
attgaaggacctgcttggaaagtatctaggctacacggctacataaaattaaagccagat
ggcactttccatgtcaaaaatgaaggcagaaggccggtctatattgatggcaagcctgta
acaactggttcacgttcaacgcttccaaacaattgtacattcgaggtatgcggcttgaaa
tttattttcttaatcagtaaaacgactgtagcgaaggcatgtaatgaccctgggcagtag

DBGET integrated database retrieval system