KEGG   Trichoplax adhaerens: TRIADDRAFT_30763Help
Entry
TRIADDRAFT_30763  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K11674  
microspherule protein 1
Organism
tad  Trichoplax adhaerens
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 399 aa AA seqDB search
RRSSSRSIKRKKFDDELVESSLKKTAKKIASANEIAAIPQVVIKDKKVLIVSINNNIHDP
IAPCRSHTMKNLGRWKPADDLALISAVQQTNDLAAVHLAVKFSCRFTLRDIEERWYSLLY
DPVISKLAISAIKPLHPDTIAAAQNNALWSKEEQQLLGGITSVNSPSLDVFKQMLMDNAD
TFHTSRTPKTLYNHWLLMRQYRLLPDQLVELSGKRETISFSDVERELDDEELTENRDEIL
DNEIAIAHRKSKLQIKKLETELPKWQEILDKIYDDDTPTFDFDSDTLAVLRGRLVRYFIR
KKEVTFGRAATDGDIDIDLSIEGPAWKVSRLHGYIKLKPDGTFHVKNEGRRPVYIDGKPV
TTGSRSTLPNNCTFEVCGLKFIFLISKTTVAKACNDPGQ
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
aggaggagttcttctcgatcgattaaacgtaaaaagtttgatgatgaattggttgaaagt
agcctaaaaaagactgctaagaaaatcgcctcagccaatgaaatagctgcaatacctcaa
gttgtgatcaaagataaaaaggtactgatcgtctctattaataataatattcacgatcct
attgcaccatgcaggtcccatacaatgaaaaacttaggcagatggaaaccagccgatgat
ttggctctgattagtgctgtacagcagaccaatgatttagcagcggtacatttagctgtc
aaattttcttgtcgatttacattaagagacatcgaggagcgatggtattcgctattatat
gatccagtcatttcaaagttggctatttccgctattaaacctttacatccagatactatt
gctgctgctcaaaataatgccttatggagcaaagaagaacaacaactactgggtggcata
acatcggttaattcaccatcattagatgtctttaagcaaatgttaatggacaatgcagat
acatttcatactagccgaacacccaaaactttatataatcattggttgttgatgaggcag
tatcgccttttgcctgatcagttagttgaactctctggtaaacgcgaaacaatatcattt
tctgatgtggaaagggaacttgatgatgaggagctgactgaaaatcgtgatgaaatttta
gataacgaaatagccatagcccatcgaaaaagcaaattacaaattaaaaaattagaaacg
gaattgccaaaatggcaagaaatactagacaagatctatgacgatgatacgccaacattc
gatttcgatagcgatacactagctgttttacgaggacgtttggttcgctattttattcga
aagaaagaggtgacatttggacgtgctgctaccgatggcgatattgacatagatttatcc
attgaaggacctgcttggaaagtatctaggctacacggctacataaaattaaagccagat
ggcactttccatgtcaaaaatgaaggcagaaggccggtctatattgatggcaagcctgta
acaactggttcacgttcaacgcttccaaacaattgtacattcgaggtatgcggcttgaaa
tttattttcttaatcagtaaaacgactgtagcgaaggcatgtaatgaccctgggcagtag

DBGET integrated database retrieval system