KEGG   Trichoplax adhaerens: TRIADDRAFT_30868Help
Entry
TRIADDRAFT_30868  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
tad  Trichoplax adhaerens
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:tad00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    TRIADDRAFT_30868
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    TRIADDRAFT_30868
   00603 Glycosphingolipid biosynthesis - globo series
    TRIADDRAFT_30868
   00604 Glycosphingolipid biosynthesis - ganglio series
    TRIADDRAFT_30868
   00511 Other glycan degradation
    TRIADDRAFT_30868
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    TRIADDRAFT_30868
Enzymes [BR:tad01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     TRIADDRAFT_30868
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 525 aa AA seqDB search
MKTIHWFKPLILLILVAYPAMCVVWPMPQMMSTTSTVLTINSKKFTFQSSSKSDILHQAF
ERYMNISFIPLGKQIQPQLSESFNVTASSGSLTSLKVNVHSSKEELNLDSVENYTLTVTA
KGATLDADEVWGALRGRLETFSQLVEPTESGMFQINETKVIDFPRFKHRGMLVDTARHFL
DMEVLYEHIDAMAYNKYNVFHWHIVDDESFPYDSKVLPEVTAKGSFNPKTHVYTADDITK
IIKYCRYRGLRVIPEFDTPGHTRCWGRSKPNLLTKCYTGFLPNGKTGPINPIFPENYEFM
KTLLSEVHKRFTDKYIHLGGDEVLLNCWKSNPDVRNWMVEKGLGNNISLLESYYESRLLG
IASNLGYDYIIWQSVVDNNVKVMPSTVVNVYKGGFPAELDRVTKRNFTTILSSCWYLDIY
AYGPDWKRYYSCEPFSFNGTQKQYDLIIGGESCIWTEYVDDTNLISRVWPRASGTAERLW
SAKNVNSIALATPRIHDFRCKILIRRGIRAEPVTGPGFCEYEFGM
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgattcactggttcaaaccgttgattctgttgatattggtggcttatccagcc
atgtgtgtggtatggccgatgcctcaaatgatgtcaacaacctcgactgtactcacaatt
aattcaaaaaaatttacctttcaatcgagcagcaagagcgatatattacatcaggcattc
gaaagatacatgaatataagcttcattccattagggaaacaaattcaaccacaactttcg
gaatctttcaacgttactgctagtagtggtagtcttaccagtttgaaagtaaacgtccat
agttcaaaggaagaattaaatctggattctgtggaaaactatactttgacggtaacggca
aaaggagctacattagatgctgacgaagtttggggagctctaagaggtagattggaaact
tttagtcaacttgttgaacctactgaatcgggcatgttccagattaacgaaactaaagtt
atcgactttcctcgatttaaacaccgtggtatgcttgtcgatacagcaagacatttcttg
gatatggaagtactttacgaacatattgatgctatggcttataataagtataacgtattt
cactggcatatcgttgacgacgaatccttcccatatgattcaaaagtcttaccagaagtt
acggcaaagggatcctttaatcctaaaacccatgtttatactgctgatgatattaccaaa
attatcaagtactgtagatatcgtggtctaagagtaattcctgaatttgatactccggga
catactcgatgttggggtcgaagtaagccaaaccttttaacaaagtgttacactggattt
ttgcctaacggcaaaactggcccaatcaatcctatatttcctgagaattacgaattcatg
aaaactttattgtctgaagttcataagagatttactgataaatatatccatctaggtggt
gatgaagtcttacttaattgctggaaaagtaaccctgatgttagaaactggatggtagag
aaaggattaggcaataatatttctctattggaatcctactacgagtccagattgttggga
attgcttccaatttaggctatgactacattatttggcagtctgttgtagataacaacgtg
aaggtaatgccgtctacggtagtcaacgtttacaaaggcggatttccagctgaattagat
agggtaacaaagagaaattttactactatcttatcttcatgttggtacttggatatttac
gcttacggacctgactggaagaggtactatagttgcgagcccttttcttttaatggtact
caaaaacaatacgacctaatcattggcggcgaatcttgtatttggaccgaatacgttgac
gataccaatctaatatcccgcgtatggccgcgggcaagtggaactgctgaacgactatgg
agtgccaaaaatgtgaacagcatcgcattagctacaccaagaatacatgattttagatgt
aaaattctaattagacgaggtattcgagctgagccagttaccggtccaggattttgcgag
tatgaatttggaatgtaa

DBGET integrated database retrieval system