KEGG   Trichoplax adhaerens: TRIADDRAFT_30868Help
Entry
TRIADDRAFT_30868  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
tad  Trichoplax adhaerens
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:tad00520]
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan degradation [PATH:tad00531]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series [PATH:tad00603]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - ganglio series [PATH:tad00604]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:tad00511]
Cellular Processes; Transport and catabolism; Lysosome [PATH:tad04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 525 aa AA seqDB search
MKTIHWFKPLILLILVAYPAMCVVWPMPQMMSTTSTVLTINSKKFTFQSSSKSDILHQAF
ERYMNISFIPLGKQIQPQLSESFNVTASSGSLTSLKVNVHSSKEELNLDSVENYTLTVTA
KGATLDADEVWGALRGRLETFSQLVEPTESGMFQINETKVIDFPRFKHRGMLVDTARHFL
DMEVLYEHIDAMAYNKYNVFHWHIVDDESFPYDSKVLPEVTAKGSFNPKTHVYTADDITK
IIKYCRYRGLRVIPEFDTPGHTRCWGRSKPNLLTKCYTGFLPNGKTGPINPIFPENYEFM
KTLLSEVHKRFTDKYIHLGGDEVLLNCWKSNPDVRNWMVEKGLGNNISLLESYYESRLLG
IASNLGYDYIIWQSVVDNNVKVMPSTVVNVYKGGFPAELDRVTKRNFTTILSSCWYLDIY
AYGPDWKRYYSCEPFSFNGTQKQYDLIIGGESCIWTEYVDDTNLISRVWPRASGTAERLW
SAKNVNSIALATPRIHDFRCKILIRRGIRAEPVTGPGFCEYEFGM
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgattcactggttcaaaccgttgattctgttgatattggtggcttatccagcc
atgtgtgtggtatggccgatgcctcaaatgatgtcaacaacctcgactgtactcacaatt
aattcaaaaaaatttacctttcaatcgagcagcaagagcgatatattacatcaggcattc
gaaagatacatgaatataagcttcattccattagggaaacaaattcaaccacaactttcg
gaatctttcaacgttactgctagtagtggtagtcttaccagtttgaaagtaaacgtccat
agttcaaaggaagaattaaatctggattctgtggaaaactatactttgacggtaacggca
aaaggagctacattagatgctgacgaagtttggggagctctaagaggtagattggaaact
tttagtcaacttgttgaacctactgaatcgggcatgttccagattaacgaaactaaagtt
atcgactttcctcgatttaaacaccgtggtatgcttgtcgatacagcaagacatttcttg
gatatggaagtactttacgaacatattgatgctatggcttataataagtataacgtattt
cactggcatatcgttgacgacgaatccttcccatatgattcaaaagtcttaccagaagtt
acggcaaagggatcctttaatcctaaaacccatgtttatactgctgatgatattaccaaa
attatcaagtactgtagatatcgtggtctaagagtaattcctgaatttgatactccggga
catactcgatgttggggtcgaagtaagccaaaccttttaacaaagtgttacactggattt
ttgcctaacggcaaaactggcccaatcaatcctatatttcctgagaattacgaattcatg
aaaactttattgtctgaagttcataagagatttactgataaatatatccatctaggtggt
gatgaagtcttacttaattgctggaaaagtaaccctgatgttagaaactggatggtagag
aaaggattaggcaataatatttctctattggaatcctactacgagtccagattgttggga
attgcttccaatttaggctatgactacattatttggcagtctgttgtagataacaacgtg
aaggtaatgccgtctacggtagtcaacgtttacaaaggcggatttccagctgaattagat
agggtaacaaagagaaattttactactatcttatcttcatgttggtacttggatatttac
gcttacggacctgactggaagaggtactatagttgcgagcccttttcttttaatggtact
caaaaacaatacgacctaatcattggcggcgaatcttgtatttggaccgaatacgttgac
gataccaatctaatatcccgcgtatggccgcgggcaagtggaactgctgaacgactatgg
agtgccaaaaatgtgaacagcatcgcattagctacaccaagaatacatgattttagatgt
aaaattctaattagacgaggtattcgagctgagccagttaccggtccaggattttgcgag
tatgaatttggaatgtaa

DBGET integrated database retrieval system