KEGG   Trichoplax adhaerens: TRIADDRAFT_31028Help
Entry
TRIADDRAFT_31028  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
tad  Trichoplax adhaerens
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tad00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    TRIADDRAFT_31028
Enzymes [BR:tad01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     TRIADDRAFT_31028
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 479 aa AA seqDB search
MAASKSVAIVGGGISGLAAAFRLARRTSPTSYKVTIFESTDRAGGWIQSTVTDEGNVLEG
GPRSVRPAGLSGRAALNLVYELGLQNSIIAVNSKHQAVSNRYIYVYNKLHKLPSGLMSML
KPISPFSKSLMYMILRDWWMHYGTKPSLKDSDESVYQFFQRRFSTEMADFLADPFCRGTS
AGDARKLSMKACFPQVVNYEEQYGSILAGALLDKAIPISEADCPLVYQAKKERWRMWTLQ
NGMETLVNELFKQLTKCGVNIQLNTKCQQMSFLSDGKVMINSSEGLQDFDHVICALPAKN
LGAILSSQHPTLSSKLSKIESITVAVVNLIYDEAIPAVNGFGHLVPSIESPGILGIIYDS
CGFPQLDSKTKSSTRFSVLMGGAWFSQIHKENATDDYYIQMAVNAVRNQLGVKLEPSTVK
LSMQRDCIPQYTIGHLPLVRQIFDYIAMHSLPMSLVGASYQGIGLADCIRNANLAADRI
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atggcagcctccaaatcagtggcaatagtaggaggtggcatttcaggtttagctgctgct
tttcgattagcaagacgaacgagtccgactagttacaaagtaaccatttttgagtcgacc
gatcgtgctggtggttggatccagagcacggtaactgacgaaggcaacgtattagaagga
ggccctcgaagtgtacgaccagctggattatccggcagagcagcgttaaatttggtgtat
gaacttggcttgcaaaattcaatcattgcagtgaattcaaagcatcaagctgtaagcaat
cgctacatttatgtctacaacaaattgcacaaacttccatctggcttgatgtccatgttg
aagccaatttctccattcagtaagtcattaatgtatatgatccttcgagattggtggatg
cattacgggactaaaccctcattgaaagattcggatgaaagcgtttatcaattttttcag
cgtcgatttagtacagagatggcagattttttagcagatcccttttgcagaggaacatcg
gcaggcgacgcgcgtaaattaagcatgaaagcatgctttcctcaagtcgtcaactacgaa
gagcagtatggatcaattttagccggagcattactcgataaagctattccaataagtgag
gctgattgtccccttgtttatcaagcgaagaaagaacgatggcggatgtggacgctgcaa
aatggtatggaaacactggttaacgagttatttaaacaattaacaaaatgtggagttaat
attcaactgaatacgaaatgccagcaaatgtcgtttttatcggatggtaaagtcatgatt
aactcaagtgaaggattacaggattttgatcacgttatatgtgcgttgccagcgaagaat
cttggtgcaattctatcgtcccagcatccgaccctttctagtaaactttcgaagattgaa
agtataactgttgctgtggttaatctaatttatgatgaagctattccagctgtaaacggc
tttggccatttagtaccttcgattgaaagtcctggaatattaggaattatttacgactct
tgtggttttcctcaactggattcaaaaacaaaatcttcgacgcgatttagtgtgttgatg
gggggtgcatggtttagccaaatccataaagaaaacgcaacagatgactattacatacaa
atggcagtgaatgctgttcggaatcagttgggtgtaaaattagagccatcgacggtcaaa
ttatcgatgcaaagagattgcattccgcagtatacaattggccatttacctcttgttagg
cagatctttgactatattgctatgcatagcttgccaatgtcattggttggtgcttcttat
caaggtattggactagccgattgcatacgtaatgcaaatttagctgctgataggatatag

DBGET integrated database retrieval system