KEGG   Trichoplax adhaerens: TRIADDRAFT_32085Help
Entry
TRIADDRAFT_32085  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K01049  
acetylcholinesterase [EC:3.1.1.7]
Organism
tad  Trichoplax adhaerens
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:tad00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 596 aa AA seqDB search
MVHTNKGPVAGIDFNVEGKTVYGYLGIPFAQPPVGSLRFQPPQPIETVWKQPFDATSLPY
ACPQGLPIPDLSQDTKHGQIREDCLYINVWTPSASSTSKLPVFVFIHGGAYFYGSGSRWQ
GKVLASNQNIIVVTMNYRLGAFGFMTPGEKVDGKHVIEPNLGLYDQRLALQWVRENIAQF
GGDPNKITASGNSVGAMSVGLHTMSPGSKGLIHRAILDSGTPQFPEFFHPDFTTPRKVFE
EAVKHSNCARANTAETVACLQDLPMQELLGAQFKTMGVYPFGFSVAVDDQFLPDNPETLL
KNGQYEKVPTMIGTTSDDGSVFVRMGGYPDIEKGLSTENFFASIDVFFKAFSKQTRSAIK
FRYTNWIKENDPLAVRDEATKLFNDYFFAAPADKCAQQYASDGVPTYYFEFAFPTKLSFI
FPSYLGVTHTMEMPQVVGYPIDKPASFLANFTDEDVKVSRRMMETWGNFIKYGGDPNTPN
LDGIAWPRFYGNSSQYYVFTASPAVRDHLRSNNMRFWNHLIPKLNATQPLSVATISTTSS
PTTKLPLTTQLSPLLQELHTYRLALWITLGAACFLAILSLILGIMVAKIRNRPMKS
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atggtccatactaataaaggccctgttgccggtatcgattttaatgttgaaggaaaaacg
gtttatggctatcttggcattccttttgcccaaccgcctgttggctctttaagatttcag
cctccacaaccgatagaaaccgtatggaaacaaccatttgatgccacatctctcccttat
gcttgtccacaaggtctaccaattcccgatctcagtcaagacactaaacatggacaaatt
agagaagattgtctctatattaatgtttggacccctagtgcaagtagtacatcaaaattg
cctgtttttgtttttatccatggtggagcttatttctatggtagtggatcacgatggcaa
ggtaaagtacttgcaagcaatcaaaatattattgttgtaactatgaattatcgcttgggt
gcttttgggtttatgacaccaggtgaaaaagtcgacggtaaacacgttattgaacccaat
ctggggttgtatgatcaacgattggctcttcaatgggttcgcgagaatatcgctcaattt
ggaggcgatcctaataaaattacagcttcgggtaattcagttggcgctatgtcagttgga
ttacataccatgtcacctggaagtaaaggattaattcatagagctattttggatagtggt
actccacaatttccggaattcttccatccagacttcaccactccacgaaaagtatttgaa
gaagctgtcaaacactctaattgtgcacgagctaatacagctgaaacagtagcttgcctt
caagatctacctatgcaagaattattaggtgctcaatttaaaaccatgggtgtctatcca
tttggcttttctgtcgctgttgatgatcaatttttgccagataatcctgaaactttactt
aaaaatggacagtacgaaaaggtacctacgatgattgggacaacatcagatgatggctcg
gtttttgtaagaatgggtggctatccagatatcgaaaaagggctatcaacagagaatttt
ttcgcttcaatagatgttttttttaaagcattcagtaaacaaactagatctgctattaaa
tttcgttatactaattggatcaaagaaaacgatcctttagctgttcgagacgaggcgacc
aaactctttaatgattacttttttgcagcacctgctgataaatgcgctcaacagtatgca
tctgatggtgtccctacttattatttcgaatttgcctttcctaccaaattgtcatttatt
ttcccttcatacctgggtgttactcacactatggagatgccacaagtagtaggctaccca
attgataagccggccagttttctagccaatttcacggatgaagatgtcaaagtatcgcga
agaatgatggagacttggggaaactttatcaaatatggcggagatcctaatactcccaat
ttagatggtatagcttggccacgattttatggtaactcttctcagtattacgtatttact
gctagcccagccgttcgagatcatttaagatcaaataacatgcgattttggaatcattta
attccaaaattgaatgctactcaacctctttcagttgctaccatatcaacaactagtagt
cctactactaagttgccattaacaactcaattatcgccactcctccaagaattgcataca
tatcgtctggcattatggattacacttggtgcagcctgtttcctagcaattttaagctta
attttaggaattatggtggctaaaattcgcaatcgtccaatgaaatcttaa

DBGET integrated database retrieval system