KEGG   Trichoplax adhaerens: TRIADDRAFT_32107Help
Entry
TRIADDRAFT_32107  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
tad  Trichoplax adhaerens
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:tad00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:tad00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:tad00471]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 452 aa AA seqDB search
RCITGNIVLIIKIWRDDLIIPNFKEFKTIIENGYNKAKELKGGKVATYIPQLSRASPDYW
GVSICTIDGQRYNLGDYDVPFCMQSCSKCISYAVALNDLSSDFVHQFVGYEPSGAVFNEL
TLNEQDQPHSPMINSGAIMVAALHKPDQHLSDRFEYIIKQFKKAAGGEYVGFDNATYISE
KETADRNYALAYYMREKKAFPPNTVLEDTMNLYFQLCSTEIDCCSGAVMAATLANGGICP
ITGEKTFSPIAVRDTLSQMFSCGMYNYSGQFAFKVIGLPAKSGVSGAILIVIPNVMGICV
WSPPLDKQGNSVRGLEFCNSLVEHCRFHRFDSLLKHSQTKFDPTNRFNDDNTGTLTAIQY
AASRGDLTALRRYFLNGYRLDIPDYDGRTALHLAAIGGHVAAVRFLVEKCDVPINYTDRW
GNTPLDDAKKFNRQQVIDILNKFLDSASNFPR
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
aggtgcattaccggaaatattgttcttattatcaaaatttggcgagatgatttaattata
ccgaactttaaggaatttaaaactattatagaaaatggatacaacaaagcgaaagagctg
aagggtggaaaagttgcaacttatattccccagctttcaagagccagtccggattattgg
ggtgtatctatatgcaccattgacggacagagatacaatctaggcgattatgatgttcct
ttttgcatgcagtcctgtagcaagtgtatcagttatgcggttgccctgaatgacttatcc
agcgacttcgtacatcaattcgttggttatgaaccaagtggagcagtattcaacgaatta
acgcttaatgaacaagaccaaccacacagtcccatgattaattctggtgctattatggtt
gctgcattacataagcctgatcaacatctgagtgatagatttgaatacattataaagcaa
tttaagaaggcggccggaggagaatatgtagggttcgataatgcgacatacatatcagaa
aaggaaactgctgatcgaaattatgcactagcttattatatgagagagaagaaggctttc
ccacctaatactgtattggaggataccatgaatttgtactttcaactttgctcaactgaa
attgattgttgtagtggagctgtaatggcagcaacattagcgaatggtggtatttgccct
ataactggtgaaaagacatttagccctatagctgtccgggataccttatcgcaaatgttt
tcgtgtggcatgtataactactctgggcaatttgcatttaaggtaatcggtttgcctgca
aaatctggggtttcaggagcaatattaatagttattcctaacgttatgggtatttgtgtc
tggtcacccccgctcgacaagcaaggcaacagcgttagaggattggaattctgcaattca
ttagtagaacactgtcgttttcatcgatttgatagcttgcttaagcattcgcagacgaag
ttcgaccctacaaatcggtttaacgatgataatactggtacactaactgcgattcaatac
gccgcttcacgtggagatttaacggcacttagacgatattttttaaatggatatagactt
gacattcctgattatgatgggagaactgcactccaccttgcagcaatcggaggccacgta
gctgctgtaagatttttagtggagaaatgtgatgttcctattaattatacagataggtgg
ggaaacactccgcttgatgatgctaagaaatttaaccggcaacaagttatcgatatattg
aataagtttcttgattcagcttcgaactttccgagatag

DBGET integrated database retrieval system