KEGG   Trichoplax adhaerens: TRIADDRAFT_32825Help
Entry
TRIADDRAFT_32825  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K10739  
replication factor A2
Organism
tad  Trichoplax adhaerens
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:tad00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    TRIADDRAFT_32825
   03420 Nucleotide excision repair
    TRIADDRAFT_32825
   03430 Mismatch repair
    TRIADDRAFT_32825
   03440 Homologous recombination
    TRIADDRAFT_32825
   03460 Fanconi anemia pathway
    TRIADDRAFT_32825
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 140 aa AA seqDB search
LIPVTVAQLLKATEDQGDTYQISGREVYQITFVGVIRSVTESAAYTQYAVDDMTKSPISV
RRWVDSEVSCNMYSTLADDTYVRVVGHLRALQGVRYVMAINIQPIEDCNEITYHILEVIH
SHLLQTKGPAIVRIFITTAN
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
ttgatacctgttaccgttgcccaattgttaaaagctacagaagatcaaggtgacacttat
caaatttctggacgagaagtttatcagattacctttgttggcgtgataagatctgttaca
gaatcggcagcttatactcaatatgcagttgacgatatgaccaaatcaccaatatctgta
cgtcgatgggtagactctgaggtaagctgcaatatgtactctacacttgcggatgataca
tatgttagagtagttggtcatttacgtgctttgcaaggagtccgatatgtcatggcaata
aatattcagccaatcgaagactgcaacgaaataacgtatcatatcttagaagttatacat
tcacatttgttgcaaactaagggccccgctatagtacgaatctttatcactactgcaaat
tga

DBGET integrated database retrieval system