KEGG   Trichoplax adhaerens: TRIADDRAFT_33396Help
Entry
TRIADDRAFT_33396  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K17610  
calcineurin B homologous protein 1
Organism
tad  Trichoplax adhaerens
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 195 aa AA seqDB search
MGSNSSLILRPEEIAAIQKETHFSPSQIQRLHSRFSTLDKRNTGSLTREEFMRIPELAIN
PLGDRIIESFFWDSTNNGAEPSINFRQFMRTLALFRPCKPNEKPQAIEEIREQKLKYAFK
MYDLDHDGKISRHELLDILHMMVGTNISDEQLGCIADRAIVEADTDEDGCISFDEFKKAL
EKVDVEQKMSIRFLH
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgggttctaattcttcattaatattacgaccggaagaaattgctgctatccaaaaagaa
actcatttttctcccagtcaaatccagcggttgcacagcagattttcgactttggataag
cgcaatactggcagtttaacgcgtgaagagtttatgcgaattcctgaacttgctatcaat
ccgctcggtgaccgcattattgagtctttcttctgggattcgacaaataatggtgcagaa
ccaagtattaactttaggcaatttatgagaacgttggctttatttagaccttgtaaacca
aatgaaaaaccgcaagcaatagaggaaattcgagaacaaaaattaaaatatgcattcaag
atgtatgatctcgatcacgatggcaaaatatccagacatgaattactcgacattctccat
atgatggtcggtacgaacatatctgatgagcagttgggttgcatcgctgatcgtgcaatc
gttgaagctgacaccgatgaagatggttgtatatcgtttgatgaattcaaaaaggcatta
gaaaaagttgacgtcgaacagaaaatgagcatccgattcctacattag

DBGET integrated database retrieval system