KEGG   Trichoplax adhaerens: TRIADDRAFT_33494Help
Entry
TRIADDRAFT_33494  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K11833  
ubiquitin carboxyl-terminal hydrolase 2/21 [EC:3.4.19.12]
Organism
tad  Trichoplax adhaerens
Brite
Enzymes [BR:tad01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     TRIADDRAFT_33494
Peptidases [BR:tad01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   TRIADDRAFT_33494
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 342 aa AA seqDB search
GVVGLKNLGNTCFMNSILQCLSNTKALTSFVLDNSYSRFISGKSSMHGKLMEAYASLMRS
MWKSDTKETALSPATFKSQIQRFAPRFVGYSQQDAQEFLRFLLAGLHEDLLHNSREKPKI
ISTEEYDELQPEDKAVYCWKLYKSTDDSKVAELFVGQLKSTLECTVCKNQSVTFDPFWDL
SLPIPKISTITLLDCLKLFTREETLSGDNMPTCSKCKTKTVCTKKLSVQKFPQILVIHFK
RFSGIHYRTKLNTLIDFPIDKLDLLNFAGTTSTISCKYNLYAISNHSGSTVGGHYTAYCK
SPHTQTWYMFNDTRVQPVSSNEVKSSQAYVLFYEQQLTQSIL
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
ggtgttgtaggattaaagaatttagggaacacgtgcttcatgaactctatcctacagtgc
ctaagcaacacgaaagctttgacctcgtttgttctcgataattcatattcacgatttata
agtggaaagagttcaatgcatgggaaactaatggaagcatatgcttctctaatgagatca
atgtggaaatctgataccaaagaaactgctttatcgcctgcaacatttaaatcacaaatt
cagcgttttgccccaagattcgttggctacagtcaacaggatgcacaggagttccttcgc
tttcttttagcgggattgcatgaggatttacttcataatagtcgagagaagcctaaaatt
attagtaccgaagaatatgatgaattacagcccgaagataaagccgtatactgttggaag
ctatataagagtaccgatgatagtaaagttgcagaactttttgtaggtcagttgaaaagc
acactggaatgtacggtttgcaaaaatcaatctgtaacctttgatccgttttgggatcta
tctctgcctattccaaagatttcgaccataacactacttgattgtttgaagttattcact
cgcgaagagacgttatcgggggataatatgccgacttgttcgaaatgtaaaacgaaaact
gtctgtactaaaaagttatccgtgcagaaatttcctcaaatcctggttatacattttaag
cgattctctgggattcattatcgtacaaagctgaataccttaatagattttcctattgat
aaattggatttgttgaactttgctggtactacttctacaatatcatgcaagtacaacctg
tacgccatatctaaccattcgggtagtactgtgggaggacattataccgcttattgtaaa
agtcctcatacacaaacatggtatatgtttaatgataccagggtacaaccagtgtcaagt
aacgaagtaaaaagttcgcaagcttacgtcttattttatgagcaacagttaacccaatcg
attctttga

DBGET integrated database retrieval system