KEGG   Trichoplax adhaerens: TRIADDRAFT_33592Help
Entry
TRIADDRAFT_33592  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K08292  
elongation factor 2 kinase [EC:2.7.11.20]
Organism
tad  Trichoplax adhaerens
Brite
Enzymes [BR:tad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.20  elongation factor 2 kinase
     TRIADDRAFT_33592
Protein kinases [BR:tad01001]
 Serine/threonine protein kinases: Atypical group
  Alpha family [OT]
   TRIADDRAFT_33592
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 600 aa AA seqDB search
MENGRGSTLTKQWKSAFIKAKELPDPWAEYDIENRCQTELAKRHRYNAATKTWLEDRVLV
KIDDESFAHGAMRQCYRMKKLSNWKKVRCEEDIYDTSLEWKQALNCVAKRYIDPVERFIY
FEECKLQMDAKLWGEEYNRHNPPKKVDIIQVSIIELINRPDKPLYHIEHFVEGDYIKYNS
NSGYVDETLRATPQAFSHFTFERSGHQLIVVDVQGVGDLYTDPQIHTADAKSYGEANLGP
KGMALFFSSHTCNPLCELLSLGTFDLSSNGKQRLLTSQFSNQSSSTLSIQDFQRSDSHVN
PVSPVEESLEDYFLKRASESSSNQTTPVGSPLDSPVDDFPMEFPIIRARKTSRQRHDSGD
DGEEDRLFQQHRRSHRGSSVAAEIKLFSLKKFTGKMKNTSILGKIHFELARYNEMGRFTD
KEPDLESGFYHLLLAANLGLTDAVINAANIYLQSPHDILIDFSVEDTEENRIKGYNFMLE
AANGGDRKAMVIIAKAHDTGEIVGHERSWNEAVHWYQCAMDTADDDDAGCFDACMEDPNY
SLMVRQAELYRAGGYDLEQDLTQAAELYNSAGENATASMKGRLATKYYMIAEEIWGEIDE
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacggacggggtagtactttaaccaaacagtggaaaagtgcttttattaaagca
aaagaattacctgatccttgggcagagtatgatatcgaaaacagatgccagactgaatta
gccaaacgacatcgttataatgcagccaccaaaacttggttggaagatcgagttttggtt
aaaatagatgatgagtcgtttgcccatggagcaatgcggcagtgttacagaatgaagaaa
ttgtccaactggaaaaaagtccgatgcgaggaagatatttatgatactagtcttgaatgg
aaacaagcattgaattgtgttgcaaaacgctatatcgatcctgtggaaagatttatctac
tttgaagagtgcaaactacaaatggatgccaagttatggggtgaagaatacaacagacac
aatccgccaaagaaggttgacatcattcaagtttctataatagaacttatcaacagacca
gataagccactatatcacatagagcattttgtggaaggagattacatcaagtataattca
aactctggttatgttgacgagacattacgcgcaacaccccaagcctttagccattttacc
tttgagcgttctggccatcaactgattgtcgtggatgtccaaggcgttggcgacttatat
actgatcctcaaattcataccgccgacgctaaaagctacggagaagcaaatttgggacca
aaaggcatggcactcttctttagttcccatacttgcaatccattatgcgaattattgagt
cttggtacctttgatttaagtagcaatggaaagcaacgattactgacaagtcaatttagc
aatcaatcttcctccaccttatcaatacaagactttcaaagaagcgattctcatgttaat
ccagtttcacccgttgaagaaagtttagaagactacttcttaaaaagagctagcgaaagt
tcctcgaatcagacgacacctgtaggatcaccgttagattctccagtcgatgattttcca
atggaatttcctatcataagagctcggaaaacgtcacgacaaagacatgatagtggtgac
gatggtgaagaagatagactattccagcaacacagacgatcacatagaggctctagtgtg
gctgctgaaattaagctttttagcttaaagaaatttaccggtaaaatgaagaatacgtcc
attctaggaaagatacactttgaacttgcaagatataatgaaatgggtcgatttaccgat
aaagaaccagatttagagtctggattctatcatttgttattagccgctaatttaggctta
actgatgctgtcattaatgctgccaacatttatctccaatcgccccatgatattctgatt
gatttttctgtcgaagatacagaggagaataggatcaaagggtataatttcatgctagaa
gccgctaatggtggagatcgcaaggcgatggtaatcattgcaaaagctcatgatacagga
gaaatagtcggacacgaaagatcttggaatgaagcagttcactggtatcagtgtgctatg
gatactgctgatgatgacgatgcaggctgctttgacgcttgtatggaagatccgaactat
tcattaatggtacgtcaagccgagttgtatcgtgcaggtggatatgacttagaacaggat
ttaacgcaagctgcagaattatataattcagctggtgaaaatgctacggcatctatgaaa
gggcgcctcgcaactaaatattacatgatcgcggaagaaatatggggagaaattgatgaa
taa

DBGET integrated database retrieval system