KEGG   Trichoplax adhaerens: TRIADDRAFT_35180Help
Entry
TRIADDRAFT_35180  CDS       T01069                                 

Definition
expressed hypothetical protein
Orthology
K05759  
profilin
Organism
tad  Trichoplax adhaerens
Brite
Exosome [BR:tad04147]
 Exosomal proteins
  Proteins found in most exosomes
   TRIADDRAFT_35180
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 128 aa AA seqDB search
MSWQTYIDSNLLGTGKVTEAAICGLDGNLWAYSKGFQVMFTEATAIIKGIQSDSSVLAAS
GIKVNGTKYMFLQAIKDEFAYGKKGNDGVCCIKTGQCLIIGTYENGIQPGECSVAVGKVA
DYLRNSGY
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgagttggcaaacttatattgactctaacttgctgggtaccggtaaagtgacagaagct
gctatttgtggcttagatggaaacttatgggcatacagcaaaggctttcaggtaatgttc
acagaagcaacagccatcattaagggcatccaaagtgatagctcggtattagccgcaagt
ggaattaaagttaatggtaccaagtacatgtttctacaagcaataaaagatgaattcgct
tacggcaaaaaaggcaatgacggagtttgttgcatcaagacaggccaatgtttgattatt
ggcacctatgaaaatggtattcaacctggagagtgttctgtagctgttggaaaagtggcc
gattacttgaggaatagtggttattaa

DBGET integrated database retrieval system