KEGG   Trichoplax adhaerens: TRIADDRAFT_37096Help
Entry
TRIADDRAFT_37096  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K05546  
alpha 1,3-glucosidase [EC:3.2.1.84]
Organism
tad  Trichoplax adhaerens
Pathway
N-Glycan biosynthesis
Metabolic pathways
Protein processing in endoplasmic reticulum
Module
N-glycan precursor trimming
Class
Metabolism; Glycan biosynthesis and metabolism; N-Glycan biosynthesis [PATH:tad00510]
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:tad04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 947 aa AA seqDB search
MQSLFFLCLNSKLRLLLVTAIVIIAVNGVDRSNFKTCNDSSFCKRNREISPNQSPYNVVD
DSISIQGSKISFDIKNQANDALLAATVAVLRNGKARLRIKEKNPMYPRYEVEDILIKEPD
EETGVLANRDDQGIQLNFRDKQLILTLKPFRIDFLVNNTLVISVNSRGLMNFENYRKKHK
PADESTKEGSENSEAVNQVSSETEDVPAVDENLADKVGQRDEELKGLWEETFKSHSDSKP
KGPSSVGLDFSFPGVEHVYGIPEHADSLALKSTSGGDPYRLYNLDVFEYEIDNPMALYGS
IPFMLAHCAKSTVGLFWMNAAETWIDIDSNKAKDSILSRFASMLKGNEEMPQIDTHWFSE
SGIIDVFFMFGPRPNDVFEQYASLTGPTYLPPLFAIAYHQSRWNYNDEEDVRSVDSKFDE
HDIPYDVLWLDIEHTDGKKYFTWDSTKFPNPEDMQKSLAAKGRKMVTIVDPHIKRDSGYG
IDQDASNQGRYVKNKDDNVYEGWCWPGSSSWIDFINPEHRDWWASRFNLDNYPGSTNSLF
IWNDMNEPSVFNGPEITMHKDAKHFGGWEHRDVHNIFGLYAHKATADGLIARSGFKERPF
VLSRAFFAGSQRFGAIWTGDNTASWEHLKISLPMIMSISIAGLPFAGADVGGFFKNPDEE
LLVRWYQTASYQPFFRAHAHIDTRRREPWLLAEANMNIVRDAIRTRYALLPFWYTLFYQA
SVKGGTIIRPLFTEYPEDVSTFAMSDEYLIGSDLLVKPITDASASSTSIYLPGNNELWYD
IENYKWFTGPRSISMSVSLNKIPVFQRGGSIVPRKERIRRCSSLMYDDPYTLTVALNRKA
QALGQLYIDDGHSFDYSKGEFSLRKFTYEDNVLSSRPGSAYGNYKTNSWLEKIVVLGMKN
KPSKISVSGKNSTPRKLKFKYDRENRRLTVKKPEVNIVDDWEINFKF
NT seq 2844 nt NT seq  +upstreamnt  +downstreamnt
atgcaatctttattttttctgtgtctaaattctaaattaaggttattattggttaccgct
attgtaatcattgctgttaatggagtagatcggagcaatttcaaaacgtgcaacgatagt
agtttttgcaaacgcaacagagaaattagccctaatcaatctccatacaatgttgtagat
gattcaattagcattcagggatctaaaataagcttcgatataaaaaaccaggcaaatgat
gctcttttagcagctactgttgctgtattacgtaatggtaaggctagattaaggatcaag
gaaaagaatcctatgtatccgagatacgaagtagaagatattctaattaaagaaccggac
gaagagaccggggtcttggctaatcgcgatgatcagggtatccagcttaatttcagagat
aaacaacttattttgacactgaaacccttcagaatcgattttctcgttaataacactttg
gtcataagtgtcaactctcgtggtttaatgaactttgaaaactatagaaaaaagcataaa
ccagctgatgaaagcactaaggaaggtagtgaaaatagtgaggcagtaaatcaagtttca
agtgaaactgaggacgtccccgctgtagatgagaatctggccgataaagttggccaaaga
gatgaagaattgaaaggattgtgggaggaaacttttaaaagccattcagattcaaaaccg
aagggtcccagttcagtaggtttggatttttcatttcctggagtcgaacacgtatatgga
attcctgaacatgcagatagcctagcgctgaaatcgacctctggtggcgatccttatcga
ttgtataacttggatgtatttgaatatgagatcgataatcctatggcattatatggatca
attccttttatgttagcccattgtgcaaaatcaacggttggacttttctggatgaatgcc
gccgaaacttggattgatatcgattcaaataaagccaaagattcgatcctaagccgcttc
gcgtctatgctaaaaggcaatgaggaaatgccacaaattgacactcattggttttctgaa
agtggcattatcgacgtcttttttatgtttggacctagacctaatgatgtgtttgaacag
tatgcaagcttgactggaccaacttatttacctccgttatttgctatagcttatcaccag
tcaagatggaactataatgatgaagaagatgttcgaagtgtggactctaaatttgatgag
catgatattccatatgatgttctttggcttgatatcgaacataccgatggaaaaaaatac
tttacgtgggattctacgaaatttcctaaccctgaagatatgcagaaaagtcttgcagct
aaagggcgtaagatggtcacaattgtcgatccacatattaaaagggatagtggttacggt
attgatcaggatgcttcgaatcaaggacgttatgtaaagaacaaagatgataacgtttac
gagggctggtgttggccaggatcatcatcgtggattgattttataaaccctgaacatcga
gattggtgggcctccagatttaatcttgataattacccgggttcaaccaattcgcttttc
atctggaacgatatgaatgaaccctcagtttttaacggtccagagattactatgcataaa
gatgcaaagcactttggaggttgggaacatcgcgatgtccacaatatatttggactttat
gcgcataaagccacggctgatggtttaattgcccgatcaggattcaaagaaaggccattt
gtactgtcgcgtgctttttttgccggatctcagcgttttggtgctatttggactggggat
aataccgcttcatgggagcacttaaaaatctcactcccaatgattatgagcatcagtata
gctggattaccatttgctggtgctgacgtcggtggctttttcaaaaatcctgatgaagaa
cttcttgtcaggtggtatcaaacagcgtcttatcaaccgtttttccgtgcacatgcacac
attgatacccgtagaagagaaccgtggttgctagctgaggcgaatatgaatatcgtacgt
gatgcaatccgtactagatatgcattattaccgttttggtacacactcttttatcaagct
tctgtcaagggaggaacaataataagacctttgtttaccgagtatccagaagatgtgtcg
acatttgcgatgtctgatgagtatctaatcggatctgatctattagtaaaaccaattact
gatgccagtgcatctagtactagcatatacttgcctggaaataacgagctatggtacgat
atcgaaaattataaatggtttactggtcctcgtagtatttctatgagtgtttcgcttaat
aagattccagtctttcaacgcggcggaagtattgttccacggaaagagcgaattcggcgt
tgttcgtccttgatgtacgacgacccatatacgttaacagtcgcgcttaatagaaaagct
caagctttaggacagttatacattgatgatggccatagttttgattattctaagggtgaa
tttagcctacgaaaatttacgtatgaggacaacgtcctctcttcgaggcctggcagtgcg
tatgggaattataagacaaattcctggttagagaaaattgttgtcttaggaatgaaaaat
aaaccgtctaaaatatctgtatctggaaaaaattccacacctcgtaaattgaagtttaaa
tatgatcgcgaaaatagacgcttaactgtaaagaaacctgaagtgaatatagttgacgat
tgggaaattaattttaaattttaa

DBGET integrated database retrieval system