KEGG   Trichoplax adhaerens: TRIADDRAFT_37186Help
Entry
TRIADDRAFT_37186  CDS       T01069                                 

Definition
expressed hypothetical protein
Orthology
K08738  
cytochrome c
Organism
tad  Trichoplax adhaerens
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tad00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    TRIADDRAFT_37186
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 108 aa AA seqDB search
MSVPDGDPTKGAKLFKQRCSQCHTTEKGGKHKTGPNLHGLIGRKTGQAPGFTYTPSNINK
GITWGPDTLFQYLENPKKYIPGTKMVFAGLKKKNERADLIAFLKEATK
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atgagtgttcctgatggtgatccaacaaagggtgcaaaacttttcaagcaacgctgttcc
caatgccacaccaccgaaaagggtggaaagcataagactggacctaatttacatggcttg
attggaagaaaaacgggtcaagcacctggattcacttatacccctagtaatattaacaaa
ggtatcacttggggacctgataccctcttccaatatttggaaaatcccaaaaaatacatc
cctggaactaaaatggtatttgctggcttgaagaaaaagaatgaacgagccgatctaatc
gcctttttaaaggaagcaacgaaatag

DBGET integrated database retrieval system