KEGG   Trichoplax adhaerens: TRIADDRAFT_37186Help
Entry
TRIADDRAFT_37186  CDS       T01069                                 

Definition
(RefSeq) expressed hypothetical protein
  KO
K08738  cytochrome c
Organism
tad  Trichoplax adhaerens
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Motif
Other DBs
NCBI-GeneID: 6751111
NCBI-ProteinID: XP_002109343
JGI: 37186
UniProt: B3RNR9
AA seq 108 aa AA seqDB search
MSVPDGDPTKGAKLFKQRCSQCHTTEKGGKHKTGPNLHGLIGRKTGQAPGFTYTPSNINK
GITWGPDTLFQYLENPKKYIPGTKMVFAGLKKKNERADLIAFLKEATK
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atgagtgttcctgatggtgatccaacaaagggtgcaaaacttttcaagcaacgctgttcc
caatgccacaccaccgaaaagggtggaaagcataagactggacctaatttacatggcttg
attggaagaaaaacgggtcaagcacctggattcacttatacccctagtaatattaacaaa
ggtatcacttggggacctgataccctcttccaatatttggaaaatcccaaaaaatacatc
cctggaactaaaatggtatttgctggcttgaagaaaaagaatgaacgagccgatctaatc
gcctttttaaaggaagcaacgaaatag

DBGET integrated database retrieval system