KEGG   Trichoplax adhaerens: TRIADDRAFT_37186Help
Entry
TRIADDRAFT_37186  CDS       T01069                                 

Definition
expressed hypothetical protein
Orthology
K08738  
cytochrome c
Organism
tad  Trichoplax adhaerens
Pathway
Sulfur metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:tad00920]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 108 aa AA seqDB search
MSVPDGDPTKGAKLFKQRCSQCHTTEKGGKHKTGPNLHGLIGRKTGQAPGFTYTPSNINK
GITWGPDTLFQYLENPKKYIPGTKMVFAGLKKKNERADLIAFLKEATK
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atgagtgttcctgatggtgatccaacaaagggtgcaaaacttttcaagcaacgctgttcc
caatgccacaccaccgaaaagggtggaaagcataagactggacctaatttacatggcttg
attggaagaaaaacgggtcaagcacctggattcacttatacccctagtaatattaacaaa
ggtatcacttggggacctgataccctcttccaatatttggaaaatcccaaaaaatacatc
cctggaactaaaatggtatttgctggcttgaagaaaaagaatgaacgagccgatctaatc
gcctttttaaaggaagcaacgaaatag

DBGET integrated database retrieval system