KEGG   Trichoplax adhaerens: TRIADDRAFT_37496Help
Entry
TRIADDRAFT_37496  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K00289  
formyltetrahydrofolate dehydrogenase [EC:1.5.1.6]
Organism
tad  Trichoplax adhaerens
Pathway
One carbon pool by folate
Brite
KEGG Orthology (KO) [BR:tad00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    TRIADDRAFT_37496
Enzymes [BR:tad01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.6  formyltetrahydrofolate dehydrogenase
     TRIADDRAFT_37496
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 921 aa AA seqDB search
MLSANQLVRRFGTSTVANSRLKLAIIGQSLFGMEVYKVLRQNGHEVVGVFTVPDIAGKPD
PLAAQAQQDGVRVFKYPRWRKKGQAIPEVLNEYKEVGADLNVMPFCSQFIPMDVINHPKH
GSIVYHPSILPRHRGASAINWTIMEGDPKAGFTIFWADDGLDTGPILLQRSTELYPNDTV
DTIYNRFLYPQGINAMATAVDLVATGDAPRVTQSEEGATYDKMWKDKSVAKINWDQPAQV
LHNFIRGNDKLPGAWGTIEGQQVTFYGSTIPMISNKPEGTEIKIEGLSKPAIVHARGLTI
YGSDDQPVLVKSLQFEDGKMIAASNYGQVEESDESLELTDEEKGIIANIRTIWAGILAHD
NIEDETDFFKGGGGSMDVARLVEEVKQKCGVALTPEEVYMSTQYKDFGTMVIKKFRGGDE
LEFDFESVDLHVNDMDVKIPHQLFINNQFVDSISGKFFKTINPTDESVICKVSYATEEDV
NVAVQAAKEAFEGDWGKMNARDRGKLMYRLADLMEEHLEELATIETLDSGAVYTLALKTH
IGMSIDTFRYFAGYCDKIHGKTIPINNARPSHNLCLTRREPLGVCGIVIPWNYPLMMLAW
KMSSCLAAGNTCVLKPAEVTPLSALKFAELTVKAGFPKGVINILPGSGRVCGQAICDHPD
IRKVGFTGSTPIGRTVMKSAAESNLKKVSLELGGKSPLIIFQDCDMDKAVRQGMLSSLFN
KGENCIAAGRIFVEESIHDEYVARLVEEVKKLKIGDPFDRSTAHGPQNHEKHMVKLLEYV
DQAVAEGATLVYGGKRLDRSGFFMEPAVLTNVADDNYAAIEESFGPVLVISSFKDGDVDG
VLKRANKTEYGLASGVFTKDINKALLCSEKLDAGTVFVNTYNKTDVASPFGGFKQSGFGK
DLGEEALNEYLKTKTVTIEYD
NT seq 2766 nt NT seq  +upstreamnt  +downstreamnt
atgctgtctgccaatcaacttgtgagacggtttggtaccagcactgtggccaactctcgc
ttgaaattagccattatcggtcaaagtttgttcggtatggaagtgtacaaggttttgagg
cagaatggccatgaagtagttggtgtatttactgtgccagatattgctggaaaacccgat
ccattagctgctcaagcccaacaagatggtgttcgtgtatttaaatatccacgatggcga
aaaaagggccaagcaatacctgaagtcttgaatgaatataaagaagttggagccgattta
aatgttatgcccttttgtagccaatttatccccatggatgtcatcaatcatcccaagcat
ggctcgatagtttatcatccctccattttgccaagacatcgcggtgcatcagctatcaat
tggacaatcatggaaggtgatccgaaagctggatttacaatcttttgggctgatgatggc
ctcgatacaggcccaattcttctacaacggtcaactgaattgtaccctaatgacactgta
gataccatttacaatcgtttcctatatcctcaaggtattaatgctatggcaactgcggta
gatttggtagctactggcgatgcacccagagtaactcagtcagaagaaggagcaacatac
gacaaaatgtggaaagacaaaagcgttgcaaagatcaattgggatcaacctgctcaagta
cttcataatttcattcgcggaaacgataagctaccgggtgcttggggaacgattgagggc
cagcaagtaactttctacggctcaacaataccgatgatcagtaacaaaccagaaggaaca
gaaatcaaaattgaaggattaagtaaaccagctattgtacacgcaagaggtttaacaatc
tatggcagcgatgatcaaccagttttagtcaagtctctacaatttgaagatggtaaaatg
attgccgctagcaactacggtcaagttgaagaaagcgacgagtctctcgaattgactgat
gaagaaaaaggaataattgctaatatcagaactatttgggcaggtatccttgcacatgat
aatattgaagatgaaaccgactttttcaaaggcggcggcggttcaatggatgtcgccaga
cttgtcgaggaagtaaagcaaaaatgtggagtagctttgactcctgaagaagtctatatg
agcacacagtataaagactttggaactatggttatcaaaaaattccgtggtggtgacgaa
ctggaattcgattttgaatctgtcgatctacatgtcaatgatatggatgttaaaatccca
catcaattattcattaacaaccagtttgttgactctatctctggcaaattttttaaaaca
ataaatccaacggatgaatcggtaatatgcaaagtttcatatgctactgaagaggacgta
aatgtcgccgttcaagctgcaaaggaagcctttgaaggtgattggggtaaaatgaatgct
cgcgatcgtggcaagctgatgtacagattggctgatctgatggaagaacatttagaagaa
ttagctacaatagaaactttggactctggagcagtatataccctagctctaaagactcat
attggcatgtcaattgacacattcagatattttgccggttattgtgataaaattcatgga
aaaactattccaatcaacaatgccaggccaagtcataacctttgccttaccagacgtgaa
ccattaggtgtttgtggaattgtaattccatggaattatcccttgatgatgttagcttgg
aaaatgtcgtcttgcctagcagccggtaatacttgcgtgttaaagcctgctgaggttaca
cctctttcagctcttaaatttgctgaactaaccgtcaaagctggattccctaagggagtt
attaacattttgcctggtagcgggcgtgtctgcggtcaagcaatttgtgaccatcccgat
attcgtaaagtcggctttacaggatcaacaccaattggaagaaccgtcatgaaaagtgct
gctgaaagtaacttgaaaaaggtatctttggaacttggaggaaaatctcctctcataatt
ttccaggattgcgatatggataaagccgttcgacagggtatgttgtctagtcttttcaac
aaaggagaaaactgtattgcagccggacgcatttttgttgaagaatcaattcatgacgaa
tatgttgcacgtttggtagaggaagttaaaaagttgaaaattggtgatccattcgatcga
tcaacagcacacggtcctcaaaatcacgaaaagcatatggtaaaactgttagagtacgtt
gatcaagctgttgcagaaggtgccacgttggtctatggagggaaacgccttgatagatct
ggtttcttcatggaaccagctgtccttacaaatgtagccgatgacaactatgccgcgata
gaagaatcttttggccctgttcttgtcatttcaagcttcaaagatggagatgtagacggt
gtgctaaagcgcgctaacaagactgaatatggtttggcttctggcgtcttcactaaagat
atcaacaaggcgttgctttgcagcgaaaaactagatgctggaacagtttttgtgaataca
tataacaaaaccgatgttgcctctccatttggcggattcaagcagtcaggatttggaaaa
gatttaggtgaagaagcacttaatgaatatttaaagaccaagacagtaacaatcgagtac
gactaa

DBGET integrated database retrieval system