KEGG   Trichoplax adhaerens: TRIADDRAFT_37758Help
Entry
TRIADDRAFT_37758  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K12047  
maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
tad  Trichoplax adhaerens
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:tad00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:tad00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 1779 aa AA seqDB search
MVININCIPLNQEIGSTQAVTTSKPTTRPTNPPTTKAPQTTAATTAATNAATTGATTQAT
IPPTPPVNPCLAVTEKNRLDCFADYSFSNPSSCANRRCCWRPISTGGVPWCIYSDKFSFY
NSTVRTMPFGIRAILMRDAFMPVHYGNAPNMIYADFQFQTNERLRMKIYDPNNKRFEVPI
PMPTMSDTDNQASDPLYEVEVLTKPVFTIIVKRKSTGTKIIDTTLGPLVFEDQYLELSTR
LPSTNLYGLGEHVHSTFMHKDFHWKRIPIFARDQAPVLNANLYGSHPMYLNVEDDAANSH
TVLLMNSNAMEVILTGAPGLQWRTTGGILDFYITMGPMPHQAVQQYIKMIGLPYFPPYWS
LGFQLCRWGYNSLDRVKQVVEEVRSFDIPHDVQYGDIDYMKHALDFTWDPVNYAGLPEFV
NDLRSRGMRYIIILDPAISDNQTAGTYPPYDNGVKMDIFIKDGEGKTLIGKVWPRGNATF
PDYTNPNTTIWWQELIVNFRKNITFDGLWIDMNEPANFVEGSMKGCPKNKYNNPPYKPLS
IFGSTLNDKTICMDSMQHWGLHYDVHSLYGFSETEPTLKAARASTGERSIVISRSTFVSS
GKYGGHWLGDNFSTWPDLAYSIIGCLEFNMFGIPYIGADICGFNGNTNENLCNRWMQLGA
FYTYSRNHNGRGNSPQHPTAFGAKLANSARKALLVRYKLLPYLYTLFYHANTDGLTVMRS
FLFEWPTDPVARNTDRQFLWGAALLITPVLTENAVKVTGYFPDSRWYDYYNGIEVGIRKG
NVELSAPYDHINVHVRGGYILPMQEAANNTYFARMNQFSLLVAMDDKITAKGNLFWDDGD
SIDTIPKDQYLYVDYTADKTSLKAVVSKNNYIAATTLGEIKVYGLSIPTVSNVQVDGTTT
EFTFDSVFKVSILTLIDIKFSTTMPITPPPTSCPAVNDNDRIDCFPDYFQSSEQTCRSRG
CCWAATNVPNAPYCFYPQNYRTYYVSKTEKKSYGQTLELTRDTATPVQYGSRISTLTADI
QYQTNERLRIKIYDPNNARYEVPITMPNLSGNDAEAPNPLYQVQIQENPFAIKVIRKATG
KAIFDTTLGPLHFENQYLEWSTKLLSKDFYGIGEHEHRSFKHQQWNWKRWGLFARDQPPT
VHGNLYGTHPMYFNIEDDQANSHAVLFFNSNAMEAVLSQSPAITWRSIGGIVDFFIFMGP
QPKQAISQYVMTTGAPYFPPYWALGFQLCRYGYGNVSRVRQVLSEMRAYDIPQDVQYGDI
DYMQTQLDFTYDPVRYKDMPALVNEVHSYGQKYIIILDPAIDTTRPAGTYPAFDEGKKMG
VFVNNSDGTMLLGKVWPPGNASFPDYTAPQTSDWWTQLCVDFHKTIPFDGLWIDMNEPAN
FGTGSIIGCPNNPYNAPPYKPHGIWGPNLNDKTICMDSIQNWGVHYNVHNLYGHSEMEPS
LRAARASTNKRSLVISRSTYVSSGKFGGHWLGDNAANWNSMAYSIIGSLEFNLFGIPYIG
ADICGFFGDSTAKLCNRWMQLGAFYTYSRNHNTLNAKPHHPPAFGAANANSARKVLHTRY
RLLPYLYNLHYEATTAGATIMRALMLEFPTDKTARGIDKQFLWGSGLLITPVLTLDAVTV
DGYFPDARWYDYYTGAQVGVRRSYLTLNAPFDHIPLHVRGGSIFVQQEPANTTYFARQNS
FSLLVAMDDTLQASGNLFWDDGETINTIANGQYLRVNYKATKSGLTATVVQNGYTAQTSL
NYITVYGLSVASINQVQLNGTSTQFDFSNNYKVIVENIF
NT seq 5340 nt NT seq  +upstreamnt  +downstreamnt
atggttatcaacattaattgcatccctttaaatcaagaaattggatcaactcaagcagtg
actacatcaaagccaacaactcggccaacaaatccacctacaaccaaagcaccgcaaaca
acagctgcaaccactgcagccacaaatgcagcaacaactggtgcaacaactcaagcaacg
ataccaccaactcctcctgttaatccttgtctagcagtcactgaaaaaaatcgactggat
tgctttgcagactattccttttccaatccttcttcctgtgcaaatcggcgctgctgttgg
aggccaatttcgaccggtggtgtaccatggtgtatctattccgacaaattttcattttac
aacagcacagttcgaacgatgcccttcggaattcgtgctatcttaatgcgggatgctttc
atgcctgttcattacggtaatgctccaaatatgatctatgcagatttccaatttcaaacc
aatgaaagattgagaatgaaaatttacgatcctaataataaaagattcgaagttcctata
ccaatgccaaccatgtcggacactgacaaccaggctagtgatcctttatatgaagtggaa
gtattgactaaaccagtttttaccattattgtaaagagaaaatcaacaggaacaaaaatc
attgatacaactcttggcccattagtatttgaagatcagtatttggaattgtcaactagg
ctaccatctactaacctctatggattaggagagcatgttcatagtacgtttatgcataag
gattttcactggaaacgtattcctatcttcgcccgcgatcaagcaccagtcctcaatgcc
aatctttacggctcacatcctatgtatttaaatgtcgaagacgatgcagccaatagtcat
accgtactattaatgaatagcaatgctatggaggttattctaacgggagcaccaggattg
caatggcgaacaaccggtggtattctcgatttttacataacgatgggcccaatgccacat
caagctgttcaacaatacattaagatgattggcttaccctactttccgccttattggtct
ttgggatttcagctatgccgttggggttataacagcttggatcgtgttaagcaagtagta
gaagaagtaagatcgtttgacataccacatgatgttcaatatggggatatcgattacatg
aagcatgccttagatttcacgtgggatccggtcaattatgctggccttcctgaatttgtc
aatgatttacgctccagaggaatgcgctacatcattatattggatccagctattagtgac
aatcaaactgcaggtacatatcctccttacgataatggagtcaagatggacatcttcatc
aaggatggtgaaggcaagactttaattggcaaggtttggcctcgaggtaacgctactttc
cctgattatacaaacccaaatactactatatggtggcaagaattaatcgtgaactttcgc
aagaacatcacatttgacggcttatggatcgatatgaatgaacctgccaattttgttgaa
ggttccatgaagggttgtccaaaaaataaatataataatccaccatataagccactcagc
atttttggcagcacattgaatgataaaactatttgcatggattctatgcaacattggggt
ctacattatgatgttcatagcttgtacggatttagtgaaacagaacccactctcaaagct
gctagagcttctacaggagagcgaagtatcgtcatatcccgatctactttcgtaagttct
ggtaaatatggtggtcattggctaggtgataacttctctacatggcctgatctagcatat
tcgatcattggctgtttggagttcaatatgtttggcatcccatatattggagcagatatt
tgcggattcaacggtaatactaatgagaacctgtgtaatcgatggatgcaactcggagca
ttctacacatatagcagaaatcacaatggtcgaggaaattcgcctcaacatccaacagct
tttggagctaaactagctaatagtgctagaaaagccctgctagttcgatataagttactc
ccctatttatacaccttattttatcacgcaaatacagatggcttaacagttatgcgttcc
tttttgtttgaatggccaactgatccagttgcaaggaatacagacagacaatttttgtgg
ggtgctgcgttattaattacgccggttttaactgagaatgccgttaaggtgaccggctac
tttcccgatagtaggtggtacgattattataatggaattgaagttggtatacgtaaagga
aatgttgaattaagtgctccatacgatcatattaacgttcacgttcgtggaggatatatc
ttacctatgcaagaagctgctaataatacctactttgcacgtatgaatcaattttcttta
ctagtcgctatggatgacaaaattactgcgaaggggaatctattctgggatgatggagat
tcaatagataccataccgaaagatcaatatctctacgtcgactatacagcagataagaca
tcattgaaagccgttgtttccaagaataattacattgctgcaacaactttaggagagatc
aaagtttatggtttatctattcctacagtcagtaatgttcaagttgatggtacaacaaca
gaatttacttttgatagcgtatttaaagtaagcattctaacactgattgatattaaattt
tcaacaaccatgccaattacaccaccacccacttcttgcccagcagtgaatgataatgat
cgtattgattgctttccagattatttccaatcttcagaacaaacatgtcgtagtcgtggt
tgttgctgggcagcaacaaatgtacccaatgctccttattgcttctatccccaaaattat
cgaacttattacgttagcaagaccgaaaaaaaatcatatggtcaaacattagaactaacc
cgcgatactgcaactcctgttcaatatggcagtcggatatcgacattaactgcagatatt
cagtatcaaaccaatgaacgacttcgaattaagatttacgatcctaacaatgctcgatat
gaggttccaattacgatgccaaatctgtccggtaatgatgcagaagctccgaaccctctc
tatcaagtccaaattcaagagaatccttttgctattaaagtcattcgtaaagcaaccgga
aaagcaatctttgatacaactctaggccctttacactttgaaaatcaataccttgaatgg
agcacaaaattattatccaaagatttctatggtattggcgaacatgaacatcgatcattt
aagcatcagcaatggaactggaaaagatggggtctattcgcaagagatcaaccacccact
gtacacggaaatttatatggcactcatcctatgtacttcaacatcgaagatgatcaagcc
aatagccatgcagttcttttcttcaacagtaatgcaatggaggccgttctttctcaaagt
ccagctataacatggcgctctattggtggcatcgtagactttttcatctttatgggacct
cagccaaaacaagcaatttcacaatatgttatgactaccggtgcaccttattttccacca
tattgggcattgggcttccagttatgtcgttatggctatggcaatgtatcgcgtgtaaga
caagttctatctgaaatgagagcttatgatattccacaggacgttcaatatggagatata
gattatatgcaaactcaattagattttacttacgatccagttcgctataaggatatgcca
gcattagttaatgaagtccattcttacggccaaaaatatatcattattctagacccagct
attgatacaactagaccagcaggtacttatccggcattcgatgaagggaaaaaaatgggc
gtttttgtcaataatagcgatggaacgatgctccttggcaaggtttggccaccaggtaat
gcatctttcccggattatactgctccacaaacatcagattggtggacccaattgtgtgtt
gactttcataaaactatcccatttgatggattatggattgatatgaatgagccagctaat
tttggaacgggttccattatcggttgtccaaacaacccatataatgctcctccttacaag
ccacatggaatatggggtcccaatcttaatgacaaaacaatctgtatggactctatacaa
aattggggagtccattacaatgttcacaatttatatggtcatagtgaaatggaacctagt
ttgagggctgctcgtgcttcgactaataaaagaagcctggttatatctcgttctacttat
gttagcagtggtaaattcggtggccattggctaggcgataacgctgctaattggaattct
atggcgtattctatcattggtagtttagagttcaatctttttggtattccatacattgga
gccgatatatgcggattctttggcgactcaaccgcaaaattatgtaatcgttggatgcaa
ttaggcgctttctacacctactcgagaaatcacaatactcttaatgcgaagcctcatcac
cctccagcatttggagctgcaaatgctaatagtgctcgcaaggttttacatacacgctat
agattactgccttatttatataatttacattatgaggcaacaacggctggtgcaacaatt
atgagggctctaatgttggagtttcccactgataaaacagctcgtggaattgacaaacag
ttcttatggggtagtggacttcttataacgcctgtactaactttggacgcagtaacagtc
gatggatattttcctgatgctagatggtatgactattatacgggtgctcaagttggagta
cgaagaagttatttaacattaaatgcaccgtttgatcacataccattacatgttcgagga
ggatctattttcgtccaacaagagccagctaatactacttattttgcacgacaaaattct
ttcagcttattggttgctatggatgataccttacaagctagtggaaacttattttgggat
gatggagagactattaatacaattgctaatggacaatatcttcgtgttaattataaagca
acaaagagtgggttgacagctaccgttgtgcaaaatggctataccgctcaaactagtttg
aattatattacagtatatggattatctgtagccagtatcaaccaagtccaactcaatggc
acttcaacgcagtttgattttagtaataattacaaggtaattgttgaaaatattttctga

DBGET integrated database retrieval system