KEGG   Trichoplax adhaerens: TRIADDRAFT_37919Help
Entry
TRIADDRAFT_37919  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K07198  
5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
tad  Trichoplax adhaerens
Pathway
FoxO signaling pathway
Regulation of autophagy
mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:tad00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    TRIADDRAFT_37919
   04150 mTOR signaling pathway
    TRIADDRAFT_37919
 Cellular Processes
  Transport and catabolism
   04140 Regulation of autophagy
    TRIADDRAFT_37919
Enzymes [BR:tad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     TRIADDRAFT_37919
Protein kinases [BR:tad01001]
 Serine/threonine protein kinases: CAMK group
  CAMKL family
   TRIADDRAFT_37919
Mitochondrial biogenesis [BR:tad03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    TRIADDRAFT_37919
  Mitophagy factors
   Other mitophagy factors
    TRIADDRAFT_37919
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 491 aa AA seqDB search
MDQKIKIGHYILGNTLGVGTFGKVKLAVHQYTHHQVAVKIINRTRIKSLDVASKIRREIQ
NLKLFRHPHIIKLYQVITTPSDIFMVMEYVSGGELFEYIIKRGRLNEADARRFFQQIISG
VDYCHRHMVAHRDLKPENLLLDSSNMVKIADFGLSNMMKDGEFLRTSCGSPNYAAPEVIS
GKPYAGPEVDVWSCGVILYALLCGSLPFDDEHVPTLFRKIKSGIYSVPSHLSRAATDLLS
IMLQVDPLKRAGIQRIREHEWFQEDLPAYLFPSSIDIDISQVDAAAIVEVCQKFGVDEAD
VRNSISIGNRHDQLLIAYHLIIDNRRIMHEAQNLSLNDAYYGSSPHKNAGSPSSCNKLDL
IHSKNTPNRSDQPKKKKSKWHLGIRSQSRPQDIMGAVYKALKKLDFQWKIVNNYQIFCRH
KNYPDGSRVKVGLRLYQVDARTYLLDFRNILPPEIESESGNADIKMSEKGDHFMMEFFEM
CAELITALAQP
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggatcagaaaattaaaattggtcattatattcttggtaatacgttaggagttgggact
ttcggaaaagtaaaacttgcggttcatcaatatactcatcaccaagtagcagtcaaaatc
attaatcggaccagaattaaaagcttggatgttgccagtaaaattcgacgtgaaatccaa
aatttaaagctattccgccatcctcatatcatcaagttgtatcaagtcataacaacgccg
tctgatatatttatggttatggaatatgtttccggcggcgaattgtttgaatatatcatt
aagcgaggcaggttgaatgaggcagatgcccgtcgtttctttcagcaaattatatctggt
gtagattactgccatcggcacatggttgcccacagagatctaaagccggaaaatttacta
ttggattctagcaatatggttaaaatagcagactttggactatcaaatatgatgaaagac
ggtgaatttctacgaacgagttgtggatctccaaattatgcagcgccggaagtaatttct
ggcaaaccgtatgcaggcccagaggttgatgtatggagttgtggggtcatattgtatgcg
ttgttatgtggctcgcttccgtttgatgatgaacatgtccctacgttgtttcgtaagata
aaaagtggtatttattccgttccttctcatttgtcaagagccgcaactgatttgctatcg
ataatgctacaagttgatccattaaagagagctggcattcaaagaattagggagcatgaa
tggtttcaggaagatctacctgcctacctatttccctctagcattgatattgatatcagc
caagtcgatgcagcagcaattgttgaagtttgtcagaaatttggtgtggatgaagccgat
gtacgaaattccattagcattggaaatagacatgatcagttacttattgcctatcatctc
ataatagataacagacggataatgcatgaagcccaaaacctaagcttgaatgatgcatat
tatgggtcttctccgcataagaatgctggctcgccttcatcgtgtaacaaactagatcta
atccatagtaagaatactccaaatcgaagtgatcagcccaaaaaaaagaaatctaaatgg
catttaggcatacgatctcaaagtcgaccacaggatattatgggagccgtttataaagct
ttaaaaaagcttgactttcaatggaaaatcgtcaacaactatcaaattttttgccgtcac
aagaactatcctgatggtagccgtgttaaggtaggactccgattataccaagttgacgct
aggacgtatctattggattttcgaaatatcttacctccagaaattgaaagtgaatctggt
aatgctgacataaaaatgagtgagaaaggagaccatttcatgatggaattttttgagatg
tgtgctgaattaataacagctctagctcaaccgtaa

DBGET integrated database retrieval system