KEGG   Trichoplax adhaerens: TRIADDRAFT_37919Help
Entry
TRIADDRAFT_37919  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K07198  
5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
tad  Trichoplax adhaerens
Pathway
FoxO signaling pathway
Regulation of autophagy
mTOR signaling pathway
Class
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:tad04068]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:tad04150]
Cellular Processes; Transport and catabolism; Regulation of autophagy [PATH:tad04140]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 491 aa AA seqDB search
MDQKIKIGHYILGNTLGVGTFGKVKLAVHQYTHHQVAVKIINRTRIKSLDVASKIRREIQ
NLKLFRHPHIIKLYQVITTPSDIFMVMEYVSGGELFEYIIKRGRLNEADARRFFQQIISG
VDYCHRHMVAHRDLKPENLLLDSSNMVKIADFGLSNMMKDGEFLRTSCGSPNYAAPEVIS
GKPYAGPEVDVWSCGVILYALLCGSLPFDDEHVPTLFRKIKSGIYSVPSHLSRAATDLLS
IMLQVDPLKRAGIQRIREHEWFQEDLPAYLFPSSIDIDISQVDAAAIVEVCQKFGVDEAD
VRNSISIGNRHDQLLIAYHLIIDNRRIMHEAQNLSLNDAYYGSSPHKNAGSPSSCNKLDL
IHSKNTPNRSDQPKKKKSKWHLGIRSQSRPQDIMGAVYKALKKLDFQWKIVNNYQIFCRH
KNYPDGSRVKVGLRLYQVDARTYLLDFRNILPPEIESESGNADIKMSEKGDHFMMEFFEM
CAELITALAQP
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggatcagaaaattaaaattggtcattatattcttggtaatacgttaggagttgggact
ttcggaaaagtaaaacttgcggttcatcaatatactcatcaccaagtagcagtcaaaatc
attaatcggaccagaattaaaagcttggatgttgccagtaaaattcgacgtgaaatccaa
aatttaaagctattccgccatcctcatatcatcaagttgtatcaagtcataacaacgccg
tctgatatatttatggttatggaatatgtttccggcggcgaattgtttgaatatatcatt
aagcgaggcaggttgaatgaggcagatgcccgtcgtttctttcagcaaattatatctggt
gtagattactgccatcggcacatggttgcccacagagatctaaagccggaaaatttacta
ttggattctagcaatatggttaaaatagcagactttggactatcaaatatgatgaaagac
ggtgaatttctacgaacgagttgtggatctccaaattatgcagcgccggaagtaatttct
ggcaaaccgtatgcaggcccagaggttgatgtatggagttgtggggtcatattgtatgcg
ttgttatgtggctcgcttccgtttgatgatgaacatgtccctacgttgtttcgtaagata
aaaagtggtatttattccgttccttctcatttgtcaagagccgcaactgatttgctatcg
ataatgctacaagttgatccattaaagagagctggcattcaaagaattagggagcatgaa
tggtttcaggaagatctacctgcctacctatttccctctagcattgatattgatatcagc
caagtcgatgcagcagcaattgttgaagtttgtcagaaatttggtgtggatgaagccgat
gtacgaaattccattagcattggaaatagacatgatcagttacttattgcctatcatctc
ataatagataacagacggataatgcatgaagcccaaaacctaagcttgaatgatgcatat
tatgggtcttctccgcataagaatgctggctcgccttcatcgtgtaacaaactagatcta
atccatagtaagaatactccaaatcgaagtgatcagcccaaaaaaaagaaatctaaatgg
catttaggcatacgatctcaaagtcgaccacaggatattatgggagccgtttataaagct
ttaaaaaagcttgactttcaatggaaaatcgtcaacaactatcaaattttttgccgtcac
aagaactatcctgatggtagccgtgttaaggtaggactccgattataccaagttgacgct
aggacgtatctattggattttcgaaatatcttacctccagaaattgaaagtgaatctggt
aatgctgacataaaaatgagtgagaaaggagaccatttcatgatggaattttttgagatg
tgtgctgaattaataacagctctagctcaaccgtaa

DBGET integrated database retrieval system