KEGG   Trichoplax adhaerens: TRIADDRAFT_38075Help
Entry
TRIADDRAFT_38075  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K11866  
STAM-binding protein [EC:3.1.2.15]
Organism
tad  Trichoplax adhaerens
Pathway
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:tad04144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 366 aa AA seqDB search
MSSESATPPAERLQSLSAVGASVEIKKDISPIKYFRSGIQMEKVARAYAKEGDLERAYKI
LHRLFIEKLPKHPLYKKAEASRMKEYSKKIHGALDLASDIKQRLSDQYATEYQSFLERQK
RNEIAKLAEAQSKQEECKDYNLKSVTMDPVTDDSQSALMVIEEQHPEVGALRRDSSNYIL
EQRKPSVDRSLKPATNINEIVSPTLDGLRCVKIPERLPEYFLAVVQKNTASNIETCGILS
GHLMKEVFQVTHVIIPKQHGTADSCTTEEEEEIFDYQDSRDLVTLGWIHTHPSQTSFLSS
VDLHTQYSYQIMMPEAIAIVCAPRYNQTGYFTLTRDDGLDIIGNCKEVGFHPHPSHPILF
EVGLNI
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcagaatcggcaactcctccagctgagcgtttgcagtctctgtctgctgttgga
gcttctgttgagataaaaaaagatatttcccctataaaatattttaggagcggtattcaa
atggagaaagtggctagagcctatgctaaggaaggtgacttagaaagagcttacaaaata
ctgcatagattatttattgaaaaattaccgaaacatccgttatacaaaaaagctgaagca
tctaggatgaaggaatattcaaaaaaaattcacggggcattggatttggcatcagatata
aaacagcgtctttcagatcagtatgctacggagtatcagtcatttttggaaagacagaaa
agaaatgagattgcaaaattagctgaagctcaaagcaaacaagaggaatgcaaagattat
aatttgaagtctgttaccatggatcctgtaacggatgatagccagtctgctttgatggtt
attgaggagcaacatcctgaagtaggcgcattacgacgcgattcatcgaattatatactc
gagcagaggaagccttcagtggatagatcattaaagcctgcaacaaatattaacgagata
gtgtctccgactctggatgggctgaggtgtgttaaaattcctgaacgtctgcctgaatat
ttcttagctgtggtacaaaaaaatactgcttctaacattgagacttgcggaatattgagc
ggccatttgatgaaggaggtgtttcaagtaactcacgtgataataccaaagcagcacgga
accgcagacagttgcacaactgaggaagaggaagaaattttcgattatcaagacagtaga
gatttagtcactcttggttggattcacactcacccatcccaaactagctttctatcaagc
gtcgatctacatactcaatattcataccaaataatgatgccagaggccatagctattgtc
tgtgctccaagatataatcagacagggtactttactttaacaagagatgatggtctagat
atcattggaaattgtaaagaagtcggatttcacccacatccaagtcatccaatactattt
gaggttggtttgaatatttaa

DBGET integrated database retrieval system