KEGG   Trichoplax adhaerens: TRIADDRAFT_38171Help
Entry
TRIADDRAFT_38171  CDS       T01069                                 

Definition
(RefSeq) expressed hypothetical protein
  KO
K00852  
ribokinase [EC:2.7.1.15]
Organism
tad  Trichoplax adhaerens
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:tad00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    TRIADDRAFT_38171
Enzymes [BR:tad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     TRIADDRAFT_38171
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 297 aa AA seqDB search
MCCSYVSRMPKPGETIEGHKFEVGFGGKGANQCIMAAKLGATTAMIARVGDDTFGSSTIE
NFKENGVDISKVMVTSNISTGVAPIIVNDEGENSIVIVSGANKLLSIDDVKAAGNMMSNA
KVVACQLEIPLESVYAALKTAKEFGAKTILNTAPANKDLDVSIFKFVDILCLNETETEIM
TGLAVSNVDEAKKSACILAEKGPEYVLITLGKQGAVIAGKDGKPPVHVEGVSVKAVDTTG
AGDAFVGSIAYFMAKHPQLLFAEIVKRSCHVAAVSVCRKGTQKSYPSAEDLPKDLFQ
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgtgttgcagctatgtctcaagaatgccaaaacccggtgagacaatcgagggccacaaa
tttgaagttggatttggtggtaaaggagccaatcagtgtatcatggcagcaaaactagga
gcgactacagctatgattgcaagggtgggtgatgatacctttggaagttctaccatagag
aactttaaagagaatggagtggatatatcaaaagtgatggttactagtaatatatcaacc
ggagtagcaccaataatcgtgaatgatgaaggagaaaatagtattgtgatagtatctgga
gctaataagttgctatccatcgatgatgtgaaagcggcgggtaatatgatgtctaatgct
aaagttgttgcctgccagttggaaataccactggaatcggtctatgctgctctcaagaca
gctaaagagtttggtgcaaaaacaatcttgaatactgctcctgcaaataaggatctcgat
gtctctattttcaaatttgtagatatattgtgtttaaacgaaaccgagaccgagattatg
actggtttggctgtaagtaacgttgatgaggctaagaaatctgcttgcatattagctgaa
aaaggtcctgaatacgttttgataaccctcggtaagcaaggcgccgtgattgcaggcaaa
gatggtaaacctccagtacatgtagaaggtgtcagcgtgaaggcagttgacacaacaggt
gctggggatgcgtttgttgggtctattgcatactttatggcaaagcatccgcagttgtta
tttgccgaaatagtgaagcgttcctgtcatgtggcagccgttagcgtttgcagaaaggga
acacaaaagagctatccatctgcagaagatttacctaaagatttatttcagtaa

DBGET integrated database retrieval system