KEGG   Trichoplax adhaerens: TRIADDRAFT_49594Help
Entry
TRIADDRAFT_49594  CDS       T01069                                 

Definition
(RefSeq) hypothetical protein
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
tad  Trichoplax adhaerens
Brite
Enzymes [BR:tad01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     TRIADDRAFT_49594
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PCMT Methyltransf_31 Methyltransf_25 Methyltransf_32 Methyltransf_11 Ubie_methyltran PrmA Fibrillarin MTS Methyltransf_18 GCD14 Methyltransf_23 RrnaAD Methyltransf_16 Methyltransf_3 Methyltr_RsmB-F CMAS DOT1
Motif
Other DBs
NCBI-GeneID: 6748958
NCBI-ProteinID: XP_002108537
JGI: 49594
UniProt: B3RJQ6
AA seq 230 aa AA seqDB search
MAWRSHGKSHVDLITQLRVNGVITSPYVEEAMRQVDRGLFCSHNPYQDCPQSIGYQATIS
APHMHAHALQVLASNLKEGCTILDVGSGSGYLTACMAMMVGSSGKVYGIEHIPELISLSR
NNINKFNPSLLESDRIQLIVGDGRLGYELGAPFDAIHVGAAAPVTPNALIEQLKPGGNLI
IPVGPAGGNQHLEQYTKHADGSVTKKSLMSVIYVPLTSKDSQLNVSFRRS
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggcttggaggtctcatggcaaatctcatgtcgatctaatcactcagttaagagtcaac
ggtgttataaccagcccttatgtcgaggaagcaatgcgacaagttgatcgaggcctattt
tgttctcataacccttatcaggattgcccacaatcgataggttatcaagcaacaatcagt
gcacctcatatgcatgctcatgctttgcaagttttggctagtaacttgaaggaaggttgc
actattttggacgttggttctggcagcggatacctaacagcgtgcatggccatgatggtt
ggctcaagcggtaaagtctatgggatagagcatattcctgagttgatatcgctgtctaga
aataatatcaacaaatttaatccttccttgttggaaagtgacaggatacaactcatagtt
ggcgatggaagattagggtatgaactaggcgcacctttcgatgctatccacgttggtgct
gctgcaccggttacacctaacgcgttaattgagcagttaaagccaggagggaatttaatt
attcctgttggacctgctggtggcaatcaacacctagaacaatatacgaaacacgcggat
ggtagtgttaccaaaaagtcattaatgtcggttatttatgttcctcttactagtaaagat
agtcaactcaatgtcagttttcgtcgttcatag

DBGET integrated database retrieval system