KEGG   Trichoplax adhaerens: TRIADDRAFT_49690Help
Entry
TRIADDRAFT_49690  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
tad  Trichoplax adhaerens
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tad00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    TRIADDRAFT_49690
Enzymes [BR:tad01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     TRIADDRAFT_49690
Exosome [BR:tad04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TRIADDRAFT_49690
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 671 aa AA seqDB search
MTSSGLSKLENLFQEDPYLKPHRDNFVARYDRMKNILHHINEFMGGLDNFTQGYKYFGFN
QLEDGSITYREWAPAAANLALIGEFNQWNRNSHQLKKNEFGVWEITLPPKSNGTPVIPHA
SLVKVEVTSIHGDKVDHISPWIKYAVPSRTYLAYDGIYWQTAQPYTFKYPKPKKPLSLKI
YECHVGISSPEPKIASYNHFREKVLPRIADLGYNCIQMMAVMEHTYYASFGYQVTNFFAV
SSRYGTPEELKSLIDTAHSMGITVLLDLVHSHASKNVLDGLNQFDGTDACYFHSGPQGMH
PLWDIQRFLLSNLRWYMDNYMFDGFRFDGVTSMLYHNHGTQGFSGNYEEYFGPNTDIDAV
AYLMLANYFLHTFYPDVITIAEDVSGMPGMCREIEYGGIGFDYRLAMAIPDMWIKMLKEE
KDEEWKMGHVTFILTNHRYKEKVIAYAESHDQALVGDKTIAFWLMDKEMYTNMSNLTTLT
PVIERGLALHKMIRLITFGLGGQSYLNFSGNEFGHPEWLDFPRVGNNESYSYARRQYNLV
DDDLLRYQYLYRFDKEMIRLEDIYPWLSSDKNYVSCNHEDDKVIVFEREQLLFCFNFHPY
KSFPDYTIGADRAGKYRVVLDTDHEKFGGQNRINYNTEYFTTPKPWHNRSNSLQVYLPCR
TAFVLAQSTKT
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcatctgggctatccaaactggaaaatctttttcaagaagatccatacttgaag
ccacatcgtgataattttgttgcaaggtacgaccgaatgaagaacatcttgcatcatatt
aacgaatttatgggcgggcttgacaattttactcagggctacaagtattttggctttaat
caattagaggatggctcaataacctatcgagaatgggcgccagcagctgcgaaccttgct
ttaatcggagaatttaatcaatggaacagaaattcacatcaattaaagaaaaatgaattt
ggtgtatgggaaattactttgccgcctaaatcgaatgggacaccagttattcctcatgct
tcccttgtcaaggttgaggttacttcaattcatggcgacaaggtagatcatatatcaccc
tggattaagtatgccgttccttctagaacgtatttggcttatgatggtatatactggcaa
acagcacaaccatacacgttcaaatatccaaaaccgaaaaagcctctatcgttaaaaata
tatgagtgtcatgtcggtatctcttcgcccgagccaaaaatagcctcttataaccacttt
agagaaaaagtcctacctcgaattgcggatttagggtataattgcatacaaatgatggcc
gttatggaacatacttactatgcaagctttggttaccaagtaactaatttctttgctgta
tcaagtcgttatggtacgcctgaagaattaaaatcattaattgatacagcccattcaatg
gggataacagtccttctggatcttgtccatagtcacgcgtctaaaaatgtgttagatgga
ttgaatcagtttgacggtacagatgcttgttatttccattctggacctcaaggaatgcat
cccctttgggatatacaacgatttctgttgtccaatttacgctggtacatggataattac
atgtttgacggatttcgatttgatggcgtcacatcaatgttatatcacaatcatggtacc
caaggatttagcggaaactatgaggaatattttggccctaataccgacattgatgcagtg
gcatacctaatgctggctaattatttcttgcatacattctatccggatgtcattacaatt
gcagaggacgtttcaggcatgccaggaatgtgtcgtgaaattgaatacggtggcatcggc
tttgattaccgattggccatggcaattcctgatatgtggattaaaatgcttaaggaagag
aaggatgaggaatggaagatgggccatgtcacgtttattttgacaaatcatcggtacaag
gaaaaagtaattgcatacgcagaaagccacgatcaagcattggtcggtgataagactatt
gctttctggttaatggataaggagatgtacacgaatatgtcaaacctgaccacattaacc
ccagttatagaacgaggtttagctctacacaagatgattaggctaataacctttggccta
ggaggccagagttatttaaatttttctggaaacgagtttggtcaccctgaatggttagat
tttccacgtgtaggaaataacgagagctacagttacgctagaaggcaatataatttagtc
gatgatgacttgcttcgttatcagtatctttatcgatttgataaggaaatgatacgctta
gaagatatatacccatggttatcaagcgataaaaactatgtgagttgtaatcacgaagat
gataaagtaatagtatttgaaagagaacagttgctgttttgttttaattttcatccatac
aaaagttttccggattatacgattggtgctgatagggctggaaaatatcgagttgtttta
gatacagatcatgaaaaattcggaggtcagaatcgaattaattacaacacggagtatttt
actaccccaaaaccttggcataaccggtcgaactccttacaggtatatttaccatgtcgg
accgctttcgtactggcacagagcacgaagacatga

DBGET integrated database retrieval system