KEGG   Trichoplax adhaerens: TRIADDRAFT_49810Help
Entry
TRIADDRAFT_49810  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
tad  Trichoplax adhaerens
Pathway
Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:tad00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    TRIADDRAFT_49810
Protein phosphatases and associated proteins [BR:tad01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     TRIADDRAFT_49810
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 160 aa AA seqDB search
MITNFDADEVKRLGKRFKKMDLDNSGSLSVDEFMNLPELQQNPLVQRVIDIFDQDGNGEV
DFKEFIHGVSLFSVKGDRESKLKFAFRIYDMDKDGYITNTELFRVLKMMVGSNLKDTQLQ
QIVDKTIIYADTDGDGKISFDEFCKVVASTDIHKKMVVDV
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgatcactaattttgacgctgacgaggtcaagcgtctgggaaagcgatttaagaagatg
gacttggataacagtggatctctatcggttgatgaatttatgaatttaccagaattgcag
caaaatccattagtacaaagagtgatagatatttttgatcaagatggcaatggtgaagta
gacttcaaagaatttatccacggcgtctcactctttagcgttaaaggcgacagggaatca
aaattgaagtttgcctttagaatatatgatatggataaagatggctacataacgaatact
gaattatttcgtgtactaaaaatgatggttggtagcaacctcaaagatacacagttacaa
caaattgttgacaaaactattatctatgccgacacggatggagatggaaaaatatcgttc
gatgaattttgcaaagtcgtagcctcaacagatattcacaagaagatggttgtagatgtc
taa

DBGET integrated database retrieval system