KEGG   Trichoplax adhaerens: TRIADDRAFT_49897Help
Entry
TRIADDRAFT_49897  CDS       T01069                                 

Definition
(RefSeq) hypothetical protein
  KO
K08524  retinoid X receptor alpha
Organism
tad  Trichoplax adhaerens
Brite
Transcription factors [BR:tad03000]
 Eukaryotic Type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    TRIADDRAFT_49897
Nuclear receptors [BR:tad03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   TRIADDRAFT_49897
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hormone_recep zf-C4
Motif
Other DBs
NCBI-GeneID: 6751230
NCBI-ProteinID: XP_002109459
JGI: 49897
UniProt: B3RPF4
AA seq 327 aa AA seqDB search
MSICGQRSLRRHYGVYSCEGCKGFFKRTVRKNLTYTCRDNRNCDIDKKQRNRCQYCRYQK
CLQVGMKQEAVQEERVKNSTPTSKTTLPIAIADGFPLPTYGNDEMPVEAIRDAESTLNMN
SVPYVEMQSNPVLNICQAADKQLFNLVEWAKKIPHFCDLCVDDQVILLRSGWNELLIAAF
SFRSIAVEDGLLLSTGHYIHRTSAHNAGIGAIFDRILTELVNQMRYLKMDKTELGCLRAI
ILFNPDVRGLTSADRVEKYRELVYGALEAYVKKRFPDQLCRFAKLLLRLPALRAISLKTL
EHLFFYKLIGDPPIDTFLMEMLETGSS
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatttgcggtcaaagatcgctaaggaggcattatggcgtttacagttgtgaaggt
tgcaagggtttcttcaagcgtacagtgcgcaaaaatttaacttacacatgccgtgataat
cgaaactgtgatattgataaaaagcaacgaaatcgatgtcagtattgtcgataccagaag
tgtctgcaagttggtatgaagcaagaagccgtgcaggaagagcgcgtaaagaatagcaca
ccaactagtaaaaccaccttaccgatagcaatagcggatggcttcccattaccgacatat
gggaacgatgaaatgccagttgaagctatccgagatgctgaatctacgcttaatatgaat
agtgtaccttacgtcgaaatgcaaagtaaccctgtcttaaatatttgtcaagctgcagat
aaacaactatttaatttggttgaatgggccaagaaaataccccatttctgtgatttatgt
gtcgatgaccaagtaatacttctgagatctggttggaatgaattactgatagctgcgttt
tcgtttcgatcaatagctgttgaagatggcttgctcttatcgactgggcattatattcat
cgcactagcgcgcataatgctggtattggggctatatttgataggattttaacagagttg
gttaatcaaatgagatatttaaaaatggataaaactgaattgggctgtttgagagctatt
atattgtttaatccagatgttcgcggtttgacatcagctgatagggttgaaaagtatcga
gagctggtatatggagctctagaggcttacgtcaagaaaaggtttcctgaccagctctgt
cgctttgctaaactactgcttcgattgccggccttaagagcgataagtttaaagaccttg
gagcatcttttcttttataaattaattggtgatccaccaattgacacattcttaatggaa
atgctggaaacaggcagttcttaa

DBGET integrated database retrieval system