KEGG   Trichoplax adhaerens: TRIADDRAFT_50000Help
Entry
TRIADDRAFT_50000  CDS       T01069                                 

Definition
hypothetical protein
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
tad  Trichoplax adhaerens
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:tad00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    TRIADDRAFT_50000
Enzymes [BR:tad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     TRIADDRAFT_50000
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 188 aa AA seqDB search
MALRSIAFCGPSGSGKSTLIKMLLKDYPYYFGLSISHTTRKPRQGEQNGREYYFTQRDEM
TRRIKNGEFIESAEYSGNLYGTSKKAVQDVTNSGKVCLLDIDVQGIKILKKTDLPVTYIF
IKSPNQAELEKRLRNRATETEESLQKRLKTAIIEMEFGESPGVFDHIIINDHLPDAYSNL
KAAITTVL
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atggcactacgatcgattgctttttgtggcccttctggaagcggaaaaagtaccttaatt
aagatgctactcaaagactatccttattatttcggcttaagcatatcacatactacgcgt
aaacctcgacaaggcgagcaaaacggcagggaatattattttacccaacgtgatgaaatg
actagacgtattaaaaatggagaatttattgagagtgcagaatattcgggcaatctgtat
ggtacaagcaaaaaagctgtccaagatgtaaccaatagtggaaaagtgtgtctattggat
atcgatgtccagggaataaaaatacttaaaaaaaccgatctaccagtaacttatatattc
attaagtcaccaaatcaggcagaattggagaaacgacttagaaatcgtgcgacagaaact
gaggaaagtctacagaagcgattaaaaactgcaattattgaaatggaatttggagaatca
ccaggagtctttgatcatattatcattaatgatcacttgccagatgcttatagtaacctt
aaagcagcaattacgacggtactatag

DBGET integrated database retrieval system